G3P_acyltransf - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

G3P_acyltransf - Glycerol-3-phosphate acyltransferase

PFAM:	PF02660	Sequences: LAYLLGSIPFGYLLGRLFGGIDIREVGSGNIGATNVLRTLGKKAGALTLLLDALKGALAVLLARLLLAGLAAVLGHLFPVFLGFKGGKGVATALGVLLALAPLAALIALAVWLLVAALTRYVSLASLVAAAALPLLALLLLLLFALLLALLIIWRHRANIRRL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	163 (163)
Sequences:	41298 (27317)
Seq/√Len:	2139.6
META:	0.907

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_F	51_L	3.543	1.00
69_G	96_V	3.253	1.00
57_A	99_A	2.914	1.00
11_G	31_I	2.645	1.00
115_V	128_V	2.574	1.00
26_V	39_T	2.555	1.00
33_A	49_L	2.335	1.00
2_A	68_A	2.086	1.00
21_I	26_V	2.038	1.00
77_L	89_G	2.032	1.00
9_P	82_L	2.031	1.00
154_W	157_R	2.010	1.00
57_A	61_L	1.998	1.00
37_L	45_G	1.904	1.00
3_Y	80_V	1.895	1.00
101_A	104_A	1.874	1.00
127_L	153_I	1.821	1.00
56_G	92_T	1.814	1.00
121_Y	163_L	1.808	1.00
137_A	145_A	1.795	1.00
12_Y	82_L	1.765	1.00
7_S	81_F	1.761	1.00
5_L	59_A	1.744	1.00
79_P	82_L	1.698	1.00
157_R	161_R	1.691	1.00
90_V	152_I	1.658	1.00
77_L	155_R	1.640	1.00
74_L	78_F	1.604	1.00
111_V	136_L	1.572	1.00
8_I	13_L	1.548	1.00
36_V	48_T	1.545	1.00
130_A	152_I	1.526	1.00
18_F	44_A	1.505	1.00
111_V	132_A	1.473	1.00
14_L	44_A	1.447	1.00
73_V	93_A	1.443	1.00
33_A	91_A	1.429	1.00
63_A	68_A	1.425	1.00
77_L	151_L	1.408	1.00
107_I	136_L	1.404	1.00
22_D	25_E	1.379	1.00
9_P	31_I	1.372	1.00
73_V	148_L	1.358	1.00
73_V	77_L	1.355	1.00
7_S	80_V	1.328	1.00
54_L	57_A	1.321	1.00
11_G	48_T	1.305	1.00
12_Y	31_I	1.288	1.00
90_V	126_S	1.285	1.00
19_G	44_A	1.268	1.00
14_L	51_L	1.268	1.00
98_L	105_A	1.257	1.00
23_I	31_I	1.253	1.00
30_N	88_K	1.250	1.00
116_A	125_A	1.243	1.00
131_A	153_I	1.234	1.00
2_A	71_A	1.231	1.00
115_V	119_T	1.229	1.00
134_P	149_A	1.229	1.00
61_L	65_L	1.224	1.00
158_A	162_R	1.217	1.00
132_A	136_L	1.216	1.00
36_V	40_L	1.213	1.00
31_I	82_L	1.205	1.00
53_A	98_L	1.197	1.00
121_Y	124_L	1.191	1.00
12_Y	24_R	1.188	1.00
37_L	42_K	1.184	1.00
15_G	19_G	1.183	1.00
94_L	105_A	1.173	1.00
59_A	68_A	1.155	1.00
158_A	161_R	1.147	1.00
15_G	21_I	1.145	1.00
133_L	145_A	1.131	1.00
59_A	72_A	1.126	1.00
13_L	17_L	1.121	1.00
49_L	53_A	1.117	1.00
112_W	122_V	1.115	1.00
149_A	153_I	1.113	1.00
61_L	64_R	1.113	1.00
40_L	44_A	1.110	1.00
15_G	40_L	1.102	1.00
60_V	64_R	1.101	1.00
42_K	46_A	1.091	1.00
60_V	99_A	1.084	1.00
12_Y	23_I	1.081	1.00
127_L	160_I	1.075	1.00
4_L	81_F	1.068	1.00
138_L	142_L	1.045	1.00
34_T	122_V	1.036	1.00
103_L	106_L	1.030	1.00
41_G	44_A	1.026	1.00
43_K	47_L	1.024	1.00
70_L	147_L	0.991	1.00
142_L	146_L	0.989	1.00
49_L	91_A	0.983	1.00
113_L	117_A	0.979	1.00
21_I	40_L	0.959	1.00
47_L	51_L	0.948	1.00
134_P	142_L	0.943	1.00
115_V	124_L	0.940	1.00
15_G	36_V	0.939	1.00
108_A	133_L	0.938	1.00
32_G	35_N	0.920	1.00
134_P	138_L	0.915	1.00
108_A	129_A	0.914	1.00
112_W	116_A	0.914	1.00
94_L	129_A	0.900	1.00
91_A	95_G	0.899	1.00
77_L	152_I	0.899	1.00
143_L	147_L	0.896	1.00
23_I	36_V	0.891	1.00
69_G	72_A	0.887	1.00
136_L	140_L	0.887	1.00
135_L	139_L	0.887	1.00
36_V	44_A	0.886	1.00
12_Y	15_G	0.879	1.00
93_A	148_L	0.873	1.00
3_Y	79_P	0.867	1.00
50_L	54_L	0.862	1.00
79_P	85_K	0.860	1.00
142_L	145_A	0.859	1.00
115_V	125_A	0.854	1.00
14_L	48_T	0.849	1.00
52_D	76_H	0.845	1.00
54_L	59_A	0.844	1.00
10_F	14_L	0.838	1.00
104_A	137_A	0.829	1.00
122_V	126_S	0.826	1.00
2_A	6_G	0.824	1.00
21_I	25_E	0.819	1.00
44_A	47_L	0.815	1.00
137_A	142_L	0.814	1.00
73_V	96_V	0.809	1.00
46_A	50_L	0.804	1.00
131_A	149_A	0.804	1.00
71_A	74_L	0.801	1.00
150_L	154_W	0.791	1.00
134_P	146_L	0.791	1.00
15_G	23_I	0.787	1.00
20_G	41_G	0.784	1.00
94_L	109_L	0.780	1.00
60_V	63_A	0.773	1.00
61_L	99_A	0.765	1.00
11_G	30_N	0.756	1.00
73_V	89_G	0.747	1.00
111_V	115_V	0.733	1.00
39_T	43_K	0.732	1.00
112_W	125_A	0.732	1.00
14_L	47_L	0.729	1.00
106_L	110_A	0.729	1.00
14_L	18_F	0.727	1.00
4_L	7_S	0.725	1.00
49_L	94_L	0.722	1.00
53_A	94_L	0.722	1.00
67_L	71_A	0.714	1.00
114_L	118_L	0.702	1.00
24_R	82_L	0.697	1.00
2_A	72_A	0.695	1.00
123_S	163_L	0.694	1.00
64_R	99_A	0.692	1.00
62_L	66_L	0.691	1.00
27_G	35_N	0.679	1.00
78_F	155_R	0.677	1.00
93_A	152_I	0.676	1.00
19_G	40_L	0.676	1.00
130_A	153_I	0.676	1.00
101_A	137_A	0.673	1.00
141_L	145_A	0.672	1.00
128_V	131_A	0.666	1.00
62_L	65_L	0.662	1.00
119_T	124_L	0.661	1.00
138_L	146_L	0.658	1.00
56_G	96_V	0.655	1.00
72_A	92_T	0.652	1.00
15_G	26_V	0.650	1.00
144_F	148_L	0.649	1.00
124_L	128_V	0.648	1.00
93_A	130_A	0.645	1.00
56_G	95_G	0.645	1.00
116_A	122_V	0.643	1.00
97_L	105_A	0.636	1.00
77_L	93_A	0.634	1.00
5_L	10_F	0.633	1.00
59_A	63_A	0.632	1.00
102_P	106_L	0.627	1.00
134_P	145_A	0.619	1.00
33_A	45_G	0.619	1.00
60_V	96_V	0.617	1.00
70_L	144_F	0.615	1.00
40_L	43_K	0.612	1.00
12_Y	16_R	0.610	1.00
103_L	107_I	0.604	1.00
7_S	79_P	0.604	1.00
28_S	34_T	0.597	1.00
37_L	40_L	0.597	1.00
96_V	144_F	0.595	1.00
53_A	57_A	0.592	1.00
34_T	123_S	0.591	1.00
97_L	133_L	0.588	1.00
95_G	99_A	0.586	1.00
78_F	151_L	0.584	1.00
14_L	17_L	0.582	1.00
123_S	127_L	0.573	1.00
89_G	155_R	0.573	1.00
54_L	58_L	0.572	1.00
141_L	144_F	0.569	1.00
50_L	53_A	0.565	1.00
115_V	118_L	0.565	1.00
17_L	21_I	0.562	1.00
13_L	82_L	0.553	1.00
151_L	155_R	0.550	1.00
68_A	71_A	0.547	1.00
97_L	145_A	0.547	1.00
108_A	132_A	0.540	1.00
155_R	158_A	0.540	1.00
24_R	79_P	0.537	1.00
154_W	158_A	0.536	1.00
122_V	127_L	0.533	1.00
4_L	80_V	0.533	1.00
97_L	148_L	0.532	1.00
1_L	5_L	0.531	1.00
15_G	18_F	0.530	1.00
128_V	132_A	0.530	1.00
146_L	150_L	0.528	1.00
9_P	12_Y	0.527	1.00
56_G	60_V	0.523	1.00
107_I	140_L	0.520	1.00
58_L	61_L	0.517	1.00
137_A	140_L	0.516	1.00
56_G	72_A	0.515	1.00
143_L	146_L	0.514	1.00
112_W	129_A	0.514	1.00
136_L	139_L	0.514	1.00
36_V	39_T	0.512	1.00
117_A	120_R	0.510	1.00
7_S	82_L	0.506	1.00
119_T	125_A	0.505	1.00
2_A	5_L	0.504	1.00
37_L	46_A	0.503	1.00
132_A	135_L	0.503	1.00
107_I	110_A	0.503	1.00
30_N	35_N	0.503	1.00
153_I	157_R	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2f95B	2	0.3252	3.5	0.948	Contact Map
2mfrA	1	0.2945	3.4	0.948	Contact Map
2bzwB	1	0.1656	1.4	0.959	Contact Map
4dveA	3	0.4724	1.2	0.96	Contact Map
2j5dA	2	0.2699	1.2	0.96	Contact Map
2l2tA	2	0.2638	1.1	0.961	Contact Map
2jwaA	2	0.2699	0.9	0.964	Contact Map
3wu2F	1	0.0982	0.8	0.964	Contact Map
3zuxA	1	0.4785	0.8	0.964	Contact Map
2wscI	1	0.184	0.8	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.