Mntp - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Mntp - Putative manganese efflux pump

PFAM:	PF02659	Sequences: KVRLRQALRIALFFGLFQALMPLIGWLLGSTFASYIGAFDHWIAFGLLAFIGGKMIYESFKKEEEEEEEKDPLSGKTLLLLAIATSIDALAVGVSLAFLGVNILLAALIIGVVTFLLSLLGVLLGRRLGARLGKKAEILGGLILILIGLKIL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	152 (149)
Sequences:	14166 (10982)
Seq/√Len:	899.6
META:	0.863

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_F	82_A	3.953	1.00
57_Y	61_K	3.940	1.00
19_A	111_G	3.115	1.00
59_S	138_I	2.714	1.00
54_K	57_Y	2.664	1.00
45_F	152_L	2.572	1.00
13_F	75_G	2.473	1.00
53_G	57_Y	2.300	1.00
23_L	107_A	2.256	1.00
19_A	107_A	2.247	1.00
142_L	146_L	2.124	1.00
54_K	58_E	2.044	1.00
135_K	138_I	2.019	1.00
9_R	75_G	1.933	1.00
123_L	127_R	1.928	1.00
22_P	110_I	1.926	1.00
46_G	50_F	1.841	1.00
102_N	105_L	1.775	1.00
77_T	80_L	1.767	1.00
33_A	37_G	1.745	1.00
6_Q	9_R	1.722	1.00
13_F	78_L	1.688	1.00
50_F	54_K	1.668	1.00
11_A	119_L	1.625	1.00
3_R	6_Q	1.620	1.00
52_G	141_G	1.598	1.00
56_I	138_I	1.554	1.00
16_L	20_L	1.554	1.00
52_G	145_I	1.553	1.00
7_A	119_L	1.529	1.00
13_F	79_L	1.509	1.00
17_F	82_A	1.504	1.00
5_R	9_R	1.492	1.00
124_L	128_L	1.475	1.00
49_A	53_G	1.454	1.00
131_R	135_K	1.430	1.00
45_F	49_A	1.367	1.00
30_S	33_A	1.334	1.00
114_T	118_S	1.311	1.00
109_I	113_V	1.309	1.00
56_I	141_G	1.290	1.00
123_L	126_R	1.279	1.00
10_I	122_V	1.279	1.00
28_L	31_T	1.262	1.00
11_A	115_F	1.244	1.00
127_R	130_A	1.241	1.00
13_F	16_L	1.215	1.00
105_L	109_I	1.211	1.00
24_I	90_L	1.200	1.00
42_W	46_G	1.186	1.00
49_A	145_I	1.163	1.00
18_Q	114_T	1.156	1.00
59_S	137_E	1.150	1.00
35_Y	38_A	1.149	1.00
15_G	115_F	1.149	1.00
7_A	123_L	1.145	1.00
7_A	122_V	1.145	1.00
128_L	132_L	1.139	1.00
15_G	19_A	1.126	1.00
60_F	138_I	1.116	1.00
27_L	31_T	1.112	1.00
44_A	151_I	1.101	1.00
76_K	80_L	1.091	1.00
130_A	133_G	1.083	1.00
58_E	137_E	1.081	1.00
106_A	110_I	1.075	1.00
45_F	148_G	1.075	1.00
103_I	107_A	1.074	1.00
119_L	123_L	1.073	1.00
34_S	37_G	1.069	1.00
7_A	11_A	1.061	1.00
104_L	108_L	1.056	1.00
17_F	21_M	1.053	1.00
50_F	53_G	1.051	1.00
102_N	106_A	1.026	1.00
18_Q	89_A	1.018	1.00
95_S	99_L	1.011	1.00
19_A	22_P	1.008	1.00
10_I	78_L	1.006	1.00
12_L	16_L	1.002	1.00
149_L	152_L	0.999	1.00
16_L	19_A	0.992	1.00
40_D	44_A	0.990	1.00
92_V	95_S	0.988	1.00
138_I	142_L	0.986	1.00
132_L	135_K	0.985	1.00
108_L	112_V	0.976	1.00
17_F	20_L	0.961	1.00
114_T	117_L	0.952	1.00
8_L	13_F	0.951	1.00
146_L	150_K	0.947	1.00
85_T	89_A	0.941	1.00
74_S	77_T	0.940	1.00
57_Y	60_F	0.938	1.00
95_S	98_F	0.928	1.00
30_S	34_S	0.925	1.00
60_F	63_E	0.914	1.00
55_M	140_G	0.911	1.00
75_G	79_L	0.888	1.00
4_L	7_A	0.886	1.00
121_G	125_G	0.882	1.00
28_L	32_F	0.877	1.00
61_K	64_E	0.863	1.00
33_A	97_A	0.852	1.00
9_R	13_F	0.852	1.00
32_F	35_Y	0.851	1.00
125_G	129_G	0.851	1.00
113_V	117_L	0.849	1.00
13_F	17_F	0.846	1.00
6_Q	73_L	0.844	1.00
21_M	83_I	0.843	1.00
104_L	107_A	0.822	1.00
127_R	131_R	0.822	1.00
66_E	69_E	0.816	1.00
8_L	115_F	0.815	1.00
133_G	136_A	0.814	1.00
18_Q	21_M	0.810	1.00
33_A	98_F	0.809	1.00
56_I	145_I	0.809	1.00
52_G	148_G	0.807	1.00
14_F	18_Q	0.806	1.00
14_F	118_S	0.806	1.00
37_G	40_D	0.804	1.00
23_L	27_L	0.801	1.00
23_L	104_L	0.801	1.00
65_E	68_E	0.795	1.00
10_I	13_F	0.790	1.00
79_L	82_A	0.788	1.00
29_G	94_V	0.783	1.00
49_A	149_L	0.782	1.00
26_W	103_I	0.778	1.00
132_L	136_A	0.772	1.00
49_A	148_G	0.762	1.00
120_L	123_L	0.750	1.00
4_L	119_L	0.749	1.00
71_D	74_S	0.748	1.00
10_I	73_L	0.730	1.00
6_Q	10_I	0.728	1.00
36_I	40_D	0.726	1.00
38_A	41_H	0.725	1.00
131_R	134_K	0.725	1.00
134_K	138_I	0.722	1.00
11_A	15_G	0.719	1.00
3_R	7_A	0.718	1.00
51_I	80_L	0.714	1.00
18_Q	110_I	0.708	1.00
105_L	108_L	0.704	1.00
78_L	82_A	0.702	1.00
51_I	92_V	0.694	1.00
135_K	139_L	0.692	1.00
22_P	89_A	0.690	1.00
8_L	12_L	0.685	1.00
44_A	47_L	0.681	1.00
22_P	107_A	0.676	1.00
15_G	111_G	0.674	1.00
46_G	49_A	0.673	1.00
9_R	78_L	0.671	1.00
122_V	128_L	0.670	1.00
75_G	78_L	0.658	1.00
22_P	114_T	0.654	1.00
36_I	43_I	0.648	1.00
96_L	101_V	0.646	1.00
118_S	122_V	0.641	1.00
83_I	87_I	0.640	1.00
18_Q	85_T	0.638	1.00
44_A	48_L	0.635	1.00
101_V	106_A	0.634	1.00
19_A	23_L	0.631	1.00
64_E	67_E	0.630	1.00
21_M	85_T	0.619	1.00
42_W	45_F	0.613	1.00
9_R	73_L	0.612	1.00
51_I	54_K	0.610	1.00
27_L	30_S	0.609	1.00
61_K	65_E	0.609	1.00
20_L	24_I	0.604	1.00
79_L	83_I	0.601	1.00
91_A	94_V	0.600	1.00
56_I	59_S	0.597	1.00
5_R	13_F	0.592	1.00
50_F	57_Y	0.592	1.00
4_L	8_L	0.587	1.00
92_V	97_A	0.583	1.00
126_R	132_L	0.583	1.00
112_V	116_L	0.580	1.00
17_F	79_L	0.580	1.00
11_A	122_V	0.579	1.00
62_K	67_E	0.576	1.00
96_L	110_I	0.575	1.00
56_I	60_F	0.574	1.00
73_L	76_K	0.571	1.00
29_G	98_F	0.569	1.00
145_I	149_L	0.569	1.00
90_L	94_V	0.567	1.00
113_V	116_L	0.567	1.00
89_A	114_T	0.563	1.00
51_I	81_L	0.558	1.00
23_L	103_I	0.554	1.00
31_T	34_S	0.551	1.00
95_S	106_A	0.548	1.00
141_G	145_I	0.546	1.00
97_A	100_G	0.546	1.00
60_F	64_E	0.544	1.00
12_L	115_F	0.539	1.00
134_K	137_E	0.538	1.00
11_A	22_P	0.537	1.00
73_L	77_T	0.537	1.00
94_V	98_F	0.537	1.00
51_I	58_E	0.530	1.00
26_W	106_A	0.527	1.00
64_E	68_E	0.526	1.00
47_L	51_I	0.525	1.00
65_E	69_E	0.524	1.00
126_R	131_R	0.523	1.00
140_G	144_L	0.519	1.00
63_E	66_E	0.517	1.00
136_A	139_L	0.516	1.00
94_V	99_L	0.515	1.00
93_G	125_G	0.512	1.00
9_R	12_L	0.509	1.00
117_L	121_G	0.506	1.00
53_G	60_F	0.505	1.00
72_P	77_T	0.501	1.00
139_L	143_I	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pw4A	1	0.9408	32.2	0.875	Contact Map
3wdoA	1	0.9934	31.9	0.876	Contact Map
2gfpA	2	0.9803	29	0.878	Contact Map
2cfqA	1	0.9868	26.7	0.88	Contact Map
3o7qA	1	0.9934	26.4	0.881	Contact Map
4u4vA	1	0.9342	21.7	0.885	Contact Map
3j1zP	8	0.6053	17.3	0.89	Contact Map
4j05A	3	0.8816	15.5	0.893	Contact Map
4m64A	1	0.9934	12.9	0.897	Contact Map
3pjzA	2	0.9276	12.7	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.