Vut_1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Vut_1 - Putative vitamin uptake transporter

PFAM:	PF02592	Sequences: TAGVLLFPITFLITDILTEVYGKKRARRVIWLGFAANLLAALMIWLAIALPPEAFEAVFGQTPRIVLASLIAYLVGQFLDVYVFAKLKKLTGGRHLWLRNIGSTLVSQLVDTLIFITIAFYGSLLLSLILTQYLFKVLVAVLLTPLTYLV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	150 (148)
Sequences:	18639 (10420)
Seq/√Len:	856.5
META:	0.885

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_L	110_V	3.176	1.00
48_I	56_E	2.982	1.00
45_W	49_A	2.705	1.00
17_L	29_V	2.678	1.00
64_R	122_G	2.600	1.00
54_A	57_A	2.550	1.00
31_W	78_F	2.287	1.00
109_L	133_Y	2.244	1.00
68_A	118_I	2.231	1.00
25_R	28_R	2.207	1.00
79_L	106_V	2.035	1.00
53_E	56_E	1.996	1.00
86_K	89_K	1.963	1.00
124_L	127_S	1.913	1.00
40_A	44_I	1.904	1.00
75_V	114_I	1.874	1.00
79_L	83_V	1.845	1.00
117_T	121_Y	1.828	1.00
105_L	137_V	1.806	1.00
127_S	131_T	1.713	1.00
113_L	129_I	1.690	1.00
95_H	98_L	1.688	1.00
23_K	27_R	1.670	1.00
113_L	117_T	1.648	1.00
125_L	129_I	1.642	1.00
82_Y	86_K	1.640	1.00
2_A	47_A	1.622	1.00
86_K	90_L	1.605	1.00
87_L	98_L	1.585	1.00
112_T	136_K	1.582	1.00
18_T	85_A	1.581	1.00
53_E	57_A	1.526	1.00
133_Y	137_V	1.524	1.00
38_L	70_L	1.460	1.00
34_F	74_L	1.419	1.00
30_I	81_V	1.392	1.00
91_T	95_H	1.376	1.00
128_L	132_Q	1.375	1.00
116_I	129_I	1.374	1.00
123_S	127_S	1.360	1.00
116_I	132_Q	1.348	1.00
97_W	148_Y	1.346	1.00
96_L	100_N	1.330	1.00
109_L	113_L	1.329	1.00
139_V	143_L	1.317	1.00
33_G	73_Y	1.316	1.00
45_W	48_I	1.287	1.00
71_I	118_I	1.281	1.00
31_W	35_A	1.274	1.00
126_L	130_L	1.270	1.00
23_K	85_A	1.264	1.00
24_K	27_R	1.264	1.00
31_W	74_L	1.220	1.00
72_A	114_I	1.220	1.00
76_G	107_S	1.209	1.00
117_T	129_I	1.204	1.00
27_R	78_F	1.199	1.00
39_L	43_M	1.198	1.00
24_K	28_R	1.198	1.00
98_L	102_G	1.190	1.00
65_I	119_A	1.168	1.00
6_L	43_M	1.166	1.00
87_L	102_G	1.162	1.00
126_L	129_I	1.162	1.00
124_L	128_L	1.149	1.00
146_L	149_L	1.137	1.00
143_L	146_L	1.132	1.00
100_N	144_T	1.127	1.00
79_L	82_Y	1.121	1.00
19_E	99_R	1.116	1.00
134_L	138_L	1.108	1.00
138_L	142_L	1.104	1.00
23_K	82_Y	1.104	1.00
117_T	125_L	1.099	1.00
83_V	87_L	1.096	1.00
41_A	63_P	1.088	1.00
115_F	119_A	1.081	1.00
16_I	20_V	1.076	1.00
85_A	89_K	1.071	1.00
92_G	95_H	1.059	1.00
4_V	132_Q	1.051	1.00
46_L	49_A	1.048	1.00
42_L	45_W	1.046	1.00
91_T	98_L	1.035	1.00
27_R	31_W	1.030	1.00
83_V	86_K	1.015	1.00
34_F	70_L	1.010	1.00
48_I	55_F	0.999	1.00
32_L	36_A	0.995	1.00
101_I	144_T	0.976	1.00
71_I	114_I	0.964	1.00
102_G	106_V	0.959	1.00
34_F	73_Y	0.950	1.00
41_A	45_W	0.950	1.00
116_I	128_L	0.943	1.00
44_I	59_F	0.935	1.00
96_L	147_T	0.930	1.00
78_F	82_Y	0.921	1.00
87_L	90_L	0.917	1.00
2_A	50_L	0.915	1.00
42_L	46_L	0.902	1.00
101_I	141_V	0.892	1.00
12_L	147_T	0.889	1.00
37_N	41_A	0.875	1.00
22_G	25_R	0.864	1.00
32_L	35_A	0.863	1.00
112_T	132_Q	0.863	1.00
89_K	93_G	0.861	1.00
15_D	80_D	0.854	1.00
121_Y	125_L	0.836	1.00
130_L	134_L	0.834	1.00
101_I	105_L	0.826	1.00
65_I	115_F	0.821	1.00
71_I	75_V	0.818	1.00
143_L	147_T	0.814	1.00
15_D	103_S	0.814	1.00
41_A	66_V	0.779	1.00
69_S	111_D	0.778	1.00
63_P	66_V	0.777	1.00
17_L	26_A	0.774	1.00
63_P	67_L	0.771	1.00
55_F	58_V	0.771	1.00
44_I	47_A	0.766	1.00
37_N	70_L	0.752	1.00
132_Q	136_K	0.749	1.00
129_I	133_Y	0.744	1.00
131_T	135_F	0.742	1.00
77_Q	81_V	0.726	1.00
140_A	143_L	0.725	1.00
15_D	104_T	0.718	1.00
48_I	60_G	0.715	1.00
72_A	76_G	0.712	1.00
4_V	135_F	0.709	1.00
25_R	29_V	0.709	1.00
37_N	66_V	0.708	1.00
74_L	78_F	0.707	1.00
7_F	10_T	0.704	1.00
19_E	88_K	0.703	1.00
75_V	110_V	0.701	1.00
144_T	148_Y	0.700	1.00
37_N	40_A	0.694	1.00
83_V	106_V	0.692	1.00
44_I	48_I	0.690	1.00
54_A	58_V	0.685	1.00
105_L	133_Y	0.684	1.00
113_L	130_L	0.682	1.00
61_Q	66_V	0.672	1.00
84_F	100_N	0.670	1.00
43_M	47_A	0.667	1.00
64_R	120_F	0.663	1.00
80_D	107_S	0.662	1.00
87_L	91_T	0.656	1.00
106_V	109_L	0.653	1.00
84_F	96_L	0.651	1.00
28_R	32_L	0.648	1.00
45_W	61_Q	0.646	1.00
114_I	118_I	0.641	1.00
4_V	116_I	0.636	1.00
2_A	6_L	0.635	1.00
111_D	136_K	0.634	1.00
23_K	81_V	0.632	1.00
135_F	139_V	0.612	1.00
104_T	140_A	0.608	1.00
64_R	118_I	0.607	1.00
11_F	15_D	0.605	1.00
38_L	42_L	0.605	1.00
3_G	6_L	0.601	1.00
97_W	101_I	0.601	1.00
41_A	44_I	0.601	1.00
64_R	121_Y	0.598	1.00
122_G	125_L	0.595	1.00
80_D	84_F	0.594	1.00
89_K	92_G	0.593	1.00
8_P	12_L	0.591	1.00
13_I	16_I	0.591	1.00
67_L	71_I	0.590	1.00
112_T	133_Y	0.588	1.00
120_F	128_L	0.581	1.00
82_Y	85_A	0.581	1.00
18_T	84_F	0.581	1.00
70_L	74_L	0.580	1.00
100_N	143_L	0.578	1.00
48_I	59_F	0.578	1.00
71_I	78_F	0.578	1.00
26_A	30_I	0.577	1.00
61_Q	65_I	0.574	1.00
45_W	63_P	0.573	1.00
10_T	13_I	0.572	1.00
64_R	68_A	0.572	1.00
27_R	82_Y	0.571	1.00
84_F	88_K	0.568	1.00
72_A	111_D	0.568	1.00
18_T	81_V	0.567	1.00
111_D	115_F	0.564	1.00
12_L	146_L	0.564	1.00
57_A	61_Q	0.563	1.00
80_D	103_S	0.562	1.00
127_S	130_L	0.559	1.00
123_S	126_L	0.558	1.00
14_T	80_D	0.557	1.00
72_A	110_V	0.557	1.00
18_T	26_A	0.555	1.00
90_L	98_L	0.551	1.00
11_F	14_T	0.551	1.00
64_R	125_L	0.544	1.00
62_T	66_V	0.544	1.00
67_L	118_I	0.542	1.00
56_E	60_G	0.536	1.00
144_T	147_T	0.533	1.00
98_L	101_I	0.532	1.00
41_A	62_T	0.528	1.00
4_V	8_P	0.528	1.00
109_L	129_I	0.527	1.00
30_I	34_F	0.522	1.00
49_A	56_E	0.521	1.00
124_L	131_T	0.520	1.00
35_A	38_L	0.519	1.00
12_L	143_L	0.519	1.00
72_A	118_I	0.515	1.00
125_L	128_L	0.514	1.00
14_T	18_T	0.507	1.00
48_I	58_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4humA	1	0.9467	11.1	0.905	Contact Map
3mktA	1	0.94	7.9	0.911	Contact Map
3w4tA	1	0.9533	6.4	0.915	Contact Map
4m64A	1	0.8333	5.9	0.916	Contact Map
3aqpA	1	0.9133	5.2	0.919	Contact Map
3w9iA	3	0.9	5.1	0.919	Contact Map
4rfsS	1	0.9133	4.8	0.92	Contact Map
4lz6A	1	0.5733	4.6	0.921	Contact Map
4k0jA	3	0.8733	4	0.923	Contact Map
4tphA	2	0.76	3.8	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.