Auxin_inducible - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Auxin_inducible - Auxin responsive protein

PFAM:	PF02519	Sequences: KKLKQMAKKWGRKRISSSSSSSSSSDVPPKGHFAVYVGEERKRFVVPLSYLNHPLFQELLRQAEEEFGFDPMGGLTIPCDEDVFEYLLSLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	91 (76)
Sequences:	2535 (1317)
Seq/√Len:	151.0
META:	0.06

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_V	84_F	4.156	1.00
86_Y	90_L	2.733	1.00
38_G	84_F	2.551	1.00
30_K	48_L	2.524	1.00
61_R	64_E	2.193	1.00
30_K	47_P	2.152	1.00
86_Y	89_S	2.130	1.00
71_P	74_G	2.106	1.00
82_D	85_E	2.043	1.00
63_A	78_P	2.010	1.00
80_D	83_V	2.002	1.00
36_Y	74_G	1.943	1.00
23_S	26_D	1.875	1.00
25_S	28_P	1.673	1.00
34_A	45_V	1.614	1.00
42_K	85_E	1.600	1.00
16_S	19_S	1.447	1.00
52_N	71_P	1.378	1.00
47_P	50_Y	1.359	1.00
56_F	75_L	1.334	1.00
32_H	45_V	1.318	1.00
42_K	81_E	1.317	1.00
41_R	76_T	1.299	1.00
14_R	18_S	1.292	1.00
27_V	32_H	1.284	1.00
38_G	54_P	1.278	1.00
31_G	43_R	1.254	1.00
52_N	55_L	1.181	1.00
64_E	68_G	1.159	1.00
45_V	87_L	1.130	1.00
14_R	17_S	1.129	1.00
67_F	78_P	1.116	0.99
71_P	77_I	1.089	0.99
53_H	75_L	1.083	0.99
15_I	18_S	1.071	0.99
32_H	53_H	1.068	0.99
21_S	24_S	1.033	0.99
62_Q	83_V	0.953	0.98
66_E	69_F	0.914	0.98
38_G	81_E	0.900	0.98
64_E	67_F	0.889	0.97
48_L	58_E	0.887	0.97
39_E	80_D	0.887	0.97
59_L	88_L	0.873	0.97
40_E	44_F	0.873	0.97
18_S	22_S	0.870	0.97
56_F	69_F	0.865	0.97
60_L	78_P	0.861	0.97
32_H	87_L	0.853	0.97
54_P	87_L	0.845	0.96
49_S	75_L	0.844	0.96
47_P	65_E	0.842	0.96
47_P	74_G	0.837	0.96
30_K	76_T	0.833	0.96
72_M	76_T	0.810	0.95
57_Q	61_R	0.803	0.95
54_P	84_F	0.801	0.95
66_E	70_D	0.791	0.95
45_V	53_H	0.787	0.95
80_D	90_L	0.783	0.95
68_G	78_P	0.778	0.94
50_Y	76_T	0.777	0.94
40_E	55_L	0.767	0.94
31_G	78_P	0.767	0.94
44_F	85_E	0.766	0.94
33_F	48_L	0.763	0.94
33_F	36_Y	0.740	0.93
31_G	74_G	0.735	0.93
83_V	86_Y	0.726	0.92
20_S	23_S	0.725	0.92
40_E	80_D	0.721	0.92
16_S	23_S	0.710	0.91
55_L	88_L	0.710	0.91
48_L	83_V	0.706	0.91
60_L	68_G	0.693	0.90
48_L	84_F	0.687	0.90
58_E	82_D	0.685	0.90
55_L	58_E	0.682	0.89
36_Y	50_Y	0.652	0.87
54_P	57_Q	0.651	0.87
31_G	75_L	0.646	0.87
49_S	57_Q	0.627	0.85
57_Q	74_G	0.623	0.85
51_L	65_E	0.621	0.85
32_H	81_E	0.611	0.84
48_L	52_N	0.600	0.83
51_L	62_Q	0.598	0.82
46_V	89_S	0.591	0.82
15_I	22_S	0.587	0.81
46_V	83_V	0.584	0.81
30_K	67_F	0.584	0.81
61_R	65_E	0.583	0.81
80_D	85_E	0.580	0.80
36_Y	55_L	0.575	0.80
62_Q	87_L	0.566	0.79
38_G	46_V	0.560	0.78
31_G	64_E	0.558	0.78
58_E	61_R	0.558	0.78
37_V	53_H	0.557	0.78
40_E	86_Y	0.557	0.78
19_S	35_V	0.550	0.77
41_R	77_I	0.538	0.75
55_L	80_D	0.536	0.75
46_V	70_D	0.534	0.75
60_L	64_E	0.531	0.74
16_S	20_S	0.522	0.73
63_A	75_L	0.518	0.72
18_S	24_S	0.511	0.71
45_V	79_C	0.510	0.71
49_S	53_H	0.509	0.71
57_Q	81_E	0.503	0.70
33_F	45_V	0.501	0.70
46_V	63_A	0.501	0.70
79_C	87_L	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3drxA	3	0.7582	45.6	0.893	Contact Map
1nn7A	3	0.6044	43.9	0.894	Contact Map
4crhA	1	0.6154	40.3	0.896	Contact Map
3drzA	3	0.6593	38.4	0.897	Contact Map
1s1gA	3	0.6374	37.2	0.898	Contact Map
3kvtA	4	0.6374	34.6	0.9	Contact Map
1wj6A	1	0.8022	29.6	0.903	Contact Map
1pzqA	2	0.2857	29.1	0.904	Contact Map
4bgcA	1	0.6374	29	0.904	Contact Map
4yy8A	2	0.6374	27.4	0.905	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.