Bro-N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Bro-N - BRO family, N-terminal domain

PFAM:	PF02498	Sequences: EIRTVWEENGEWWFSAVDVAEVLGYSNPRRALKKRLDKEGKELVTNQDGKKRETDVINEEGLYRLIQSSPSPKAEPFKRWLAKEVLP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	87 (81)
Sequences:	26443 (16752)
Seq/√Len:	1861.3
META:	0.87

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_S	56_V	3.112	1.00
27_N	30_R	2.477	1.00
17_V	21_E	2.400	1.00
31_A	34_K	2.234	1.00
64_R	78_K	2.021	1.00
60_E	83_K	1.976	1.00
67_Q	82_A	1.959	1.00
30_R	34_K	1.948	1.00
57_I	62_L	1.830	1.00
19_V	62_L	1.807	1.00
79_R	83_K	1.807	1.00
4_T	12_W	1.775	1.00
6_W	10_G	1.678	1.00
57_I	61_G	1.672	1.00
3_R	18_D	1.667	1.00
25_Y	28_P	1.659	1.00
59_E	63_Y	1.653	1.00
73_K	76_P	1.621	1.00
57_I	65_L	1.543	1.00
67_Q	78_K	1.530	1.00
6_W	12_W	1.513	1.00
11_E	58_N	1.456	1.00
8_E	13_W	1.451	1.00
58_N	61_G	1.415	1.00
43_L	46_N	1.378	1.00
16_A	57_I	1.344	1.00
15_S	18_D	1.276	1.00
35_R	68_S	1.255	1.00
13_W	58_N	1.254	1.00
31_A	35_R	1.206	1.00
6_W	9_N	1.202	1.00
48_D	52_R	1.190	1.00
15_S	54_T	1.187	1.00
5_V	8_E	1.140	1.00
41_K	55_D	1.132	1.00
37_D	40_G	1.114	1.00
20_A	28_P	1.090	1.00
78_K	82_A	1.089	1.00
41_K	45_T	1.063	1.00
3_R	15_S	1.060	1.00
43_L	53_E	1.052	1.00
42_E	46_N	1.019	1.00
30_R	33_K	0.999	1.00
39_E	43_L	0.995	1.00
30_R	44_V	0.970	1.00
4_T	8_E	0.963	1.00
42_E	48_D	0.948	1.00
27_N	31_A	0.941	1.00
40_G	64_R	0.941	1.00
42_E	45_T	0.922	1.00
4_T	14_F	0.918	1.00
29_R	33_K	0.916	1.00
14_F	62_L	0.894	1.00
43_L	47_Q	0.880	1.00
64_R	82_A	0.879	1.00
24_G	71_S	0.871	1.00
39_E	79_R	0.861	1.00
60_E	82_A	0.856	1.00
49_G	52_R	0.827	1.00
64_R	75_E	0.822	1.00
37_D	75_E	0.818	1.00
60_E	79_R	0.807	1.00
50_K	54_T	0.803	1.00
62_L	81_L	0.783	1.00
48_D	51_K	0.783	1.00
16_A	65_L	0.783	1.00
36_L	40_G	0.780	1.00
2_I	22_V	0.773	1.00
64_R	68_S	0.769	1.00
23_L	66_I	0.762	1.00
47_Q	50_K	0.755	1.00
69_S	74_A	0.755	1.00
43_L	55_D	0.749	1.00
42_E	56_V	0.749	1.00
63_Y	81_L	0.743	1.00
8_E	11_E	0.737	1.00
6_W	11_E	0.736	1.00
64_R	67_Q	0.736	1.00
75_E	78_K	0.735	1.00
38_K	41_K	0.730	1.00
46_N	54_T	0.711	1.00
40_G	44_V	0.708	1.00
26_S	29_R	0.702	1.00
32_L	35_R	0.696	1.00
68_S	78_K	0.693	1.00
28_P	31_A	0.686	1.00
42_E	50_K	0.681	1.00
33_K	36_L	0.672	1.00
63_Y	77_F	0.664	1.00
48_D	54_T	0.662	1.00
9_N	12_W	0.660	1.00
67_Q	81_L	0.658	1.00
22_V	77_F	0.656	1.00
20_A	69_S	0.654	1.00
24_G	29_R	0.649	1.00
34_K	37_D	0.632	1.00
31_A	45_T	0.614	1.00
13_W	56_V	0.612	1.00
37_D	41_K	0.606	1.00
64_R	79_R	0.593	1.00
66_I	78_K	0.582	1.00
26_S	30_R	0.577	1.00
40_G	43_L	0.574	1.00
72_P	75_E	0.571	1.00
44_V	47_Q	0.566	1.00
62_L	66_I	0.554	1.00
20_A	25_Y	0.553	1.00
27_N	34_K	0.549	1.00
32_L	36_L	0.547	1.00
24_G	73_K	0.545	1.00
8_E	12_W	0.545	1.00
45_T	51_K	0.540	1.00
29_R	32_L	0.539	1.00
41_K	44_V	0.534	1.00
4_T	18_D	0.523	1.00
35_R	38_K	0.523	1.00
36_L	64_R	0.515	1.00
34_K	38_K	0.503	1.00
33_K	55_D	0.503	1.00
25_Y	71_S	0.502	1.00
72_P	76_P	0.501	1.00
36_L	39_E	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4m70A	1	0.5287	65.6	0.81	Contact Map
3eyiA	1	0.6207	52.6	0.824	Contact Map
1xmkA	1	0.7471	49.7	0.828	Contact Map
1oyiA	1	0.6207	23.5	0.856	Contact Map
1qgpA	1	0.6782	23.4	0.856	Contact Map
2zkzA	2	0.7931	19.5	0.861	Contact Map
3cuoA	2	0.8276	18.6	0.862	Contact Map
1q1hA	1	0.7011	17.4	0.864	Contact Map
1sfuA	1	0.6782	15.7	0.867	Contact Map
1qbjA	1	0.6437	15.2	0.867	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.