FliD_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FliD_N - Flagellar hook-associated protein 2 N-terminus

PFAM:	PF02465	Sequences: SGLDTNSIVDQLMAAERAPLTRLQTQQTTLQAKISALGSLKSKLSALQTAASALSSASTFNARTATSSDSSVVTATASSGAAAGSYSIEVTQLATAQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	97 (96)
Sequences:	27080 (21017)
Seq/√Len:	2145.0
META:	0.89

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_D	7_S	3.119	1.00
7_S	11_Q	2.375	1.00
6_N	10_D	2.311	1.00
21_T	24_Q	2.038	1.00
19_P	22_R	1.953	1.00
5_T	9_V	1.862	1.00
17_R	20_L	1.854	1.00
11_Q	14_A	1.815	1.00
11_Q	15_A	1.792	1.00
36_A	39_S	1.791	1.00
28_T	32_A	1.716	1.00
18_A	22_R	1.692	1.00
18_A	21_T	1.661	1.00
65_A	75_A	1.659	1.00
34_I	38_G	1.655	1.00
39_S	43_K	1.648	1.00
20_L	24_Q	1.648	1.00
10_D	14_A	1.608	1.00
9_V	13_M	1.605	1.00
69_D	72_V	1.532	1.00
24_Q	27_Q	1.499	1.00
30_L	33_K	1.480	1.00
14_A	21_T	1.462	1.00
73_V	88_I	1.450	1.00
38_G	41_K	1.444	1.00
31_Q	34_I	1.432	1.00
41_K	45_S	1.424	1.00
50_A	53_A	1.418	1.00
15_A	18_A	1.405	1.00
35_S	38_G	1.387	1.00
14_A	17_R	1.381	1.00
43_K	46_A	1.381	1.00
27_Q	31_Q	1.346	1.00
28_T	31_Q	1.341	1.00
63_R	83_A	1.282	1.00
21_T	25_T	1.271	1.00
45_S	48_Q	1.269	1.00
30_L	34_I	1.260	1.00
48_Q	52_S	1.254	1.00
13_M	17_R	1.251	1.00
22_R	25_T	1.243	1.00
55_S	59_T	1.232	1.00
13_M	16_E	1.229	1.00
8_I	12_L	1.179	1.00
63_R	77_A	1.175	1.00
29_T	33_K	1.168	1.00
5_T	8_I	1.155	1.00
45_S	49_T	1.152	1.00
56_S	59_T	1.111	1.00
17_R	21_T	1.083	1.00
26_Q	29_T	1.075	1.00
24_Q	28_T	1.053	1.00
32_A	35_S	1.044	1.00
70_S	74_T	1.043	1.00
25_T	29_T	1.037	1.00
27_Q	30_L	1.034	1.00
12_L	15_A	1.003	1.00
67_S	73_V	1.003	1.00
52_S	55_S	0.984	1.00
42_S	45_S	0.983	1.00
77_A	81_A	0.962	1.00
14_A	18_A	0.950	1.00
67_S	72_V	0.946	1.00
31_Q	35_S	0.916	1.00
25_T	28_T	0.907	1.00
46_A	50_A	0.897	1.00
65_A	77_A	0.893	1.00
46_A	49_T	0.881	1.00
26_Q	30_L	0.879	1.00
59_T	62_A	0.864	1.00
22_R	26_Q	0.860	1.00
53_A	56_S	0.853	1.00
29_T	32_A	0.849	1.00
52_S	56_S	0.849	1.00
16_E	19_P	0.834	1.00
67_S	70_S	0.832	1.00
7_S	10_D	0.832	1.00
49_T	52_S	0.825	1.00
92_Q	95_T	0.809	1.00
57_A	61_N	0.809	1.00
3_L	8_I	0.805	1.00
12_L	16_E	0.805	1.00
35_S	39_S	0.794	1.00
23_L	30_L	0.790	1.00
42_S	46_A	0.778	1.00
20_L	23_L	0.775	1.00
54_L	60_F	0.767	1.00
59_T	63_R	0.764	1.00
66_T	70_S	0.758	1.00
39_S	42_S	0.753	1.00
5_T	12_L	0.745	1.00
67_S	75_A	0.740	1.00
23_L	27_Q	0.735	1.00
13_M	20_L	0.700	1.00
15_A	19_P	0.700	1.00
6_N	9_V	0.695	1.00
53_A	59_T	0.690	1.00
23_L	26_Q	0.688	1.00
32_A	36_A	0.672	1.00
40_L	43_K	0.668	1.00
74_T	77_A	0.659	1.00
8_I	11_Q	0.655	1.00
86_Y	89_E	0.648	1.00
72_V	75_A	0.635	1.00
34_I	41_K	0.634	1.00
19_P	23_L	0.633	1.00
87_S	95_T	0.629	1.00
57_A	60_F	0.628	1.00
49_T	53_A	0.622	1.00
72_V	90_V	0.618	1.00
13_M	18_A	0.617	1.00
9_V	12_L	0.608	1.00
47_L	51_A	0.606	1.00
25_T	32_A	0.598	1.00
63_R	82_A	0.597	1.00
38_G	42_S	0.597	1.00
68_S	73_V	0.589	1.00
6_N	11_Q	0.588	1.00
89_E	92_Q	0.587	1.00
72_V	89_E	0.583	1.00
48_Q	51_A	0.582	1.00
41_K	48_Q	0.569	1.00
58_S	61_N	0.555	1.00
38_G	45_S	0.553	1.00
37_L	41_K	0.547	1.00
33_K	36_A	0.545	1.00
8_I	15_A	0.538	1.00
81_A	84_G	0.531	1.00
4_D	8_I	0.529	1.00
5_T	13_M	0.529	1.00
54_L	59_T	0.527	1.00
50_A	54_L	0.524	1.00
47_L	50_A	0.522	1.00
90_V	93_L	0.520	1.00
60_F	63_R	0.519	1.00
65_A	68_S	0.518	1.00
3_L	6_N	0.515	1.00
41_K	44_L	0.512	1.00
10_D	13_M	0.504	1.00
20_L	88_I	0.502	1.00
52_S	59_T	0.502	1.00
53_A	57_A	0.501	1.00
58_S	62_A	0.501	1.00
5_T	15_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gw6A	3	0.3299	11.3	0.872	Contact Map
2vz4A	2	0.4536	8.3	0.879	Contact Map
1r8dA	2	0.5361	8.1	0.88	Contact Map
4u6uA	1	0.567	4.8	0.892	Contact Map
3n7nE	1	0.0103	4.7	0.892	Contact Map
2k5cA	1	0.6186	4.7	0.892	Contact Map
3e5nA	2	0.268	4.2	0.895	Contact Map
3tqtA	2	0.3711	4.2	0.895	Contact Map
4cwcA	2	0.299	4	0.896	Contact Map
3zg9B	1	0	3.8	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.