Keratin - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Keratin - Keratin

PFAM:	PF02422	Sequences: CYSLCLPPCGVCCPQPLANSCNEPCVRQCPDSTVVIQPPPVVVTFPGPILSSFPQESVVGSSGSAAVGSSLGSGGVPGSGGSFGYGGLGGYGGSY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	95 (91)
Sequences:	617 (237)
Seq/√Len:	24.9
META:	0.016

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_L	7_P	2.701	0.99
76_V	80_G	2.568	0.99
28_Q	53_F	2.526	0.99
80_G	87_G	2.375	0.98
29_C	32_S	2.370	0.98
85_Y	89_G	2.064	0.96
57_S	64_S	2.050	0.95
22_N	43_V	1.998	0.95
79_S	85_Y	1.932	0.94
69_S	72_G	1.884	0.93
82_S	86_G	1.866	0.93
55_Q	59_V	1.825	0.92
3_S	9_C	1.600	0.85
20_S	45_F	1.571	0.84
71_L	77_P	1.561	0.84
8_P	11_V	1.548	0.83
82_S	88_L	1.534	0.83
15_Q	19_N	1.473	0.80
14_P	55_Q	1.471	0.80
44_T	52_S	1.400	0.76
13_C	40_P	1.393	0.76
75_G	79_S	1.340	0.73
6_L	43_V	1.310	0.71
51_S	63_G	1.282	0.70
34_V	64_S	1.275	0.69
20_S	27_R	1.272	0.69
22_N	27_R	1.251	0.68
27_R	50_L	1.250	0.68
44_T	51_S	1.249	0.68
27_R	51_S	1.244	0.67
84_G	92_G	1.242	0.67
49_I	52_S	1.235	0.67
30_P	53_F	1.234	0.67
66_A	71_L	1.230	0.66
33_T	44_T	1.228	0.66
82_S	89_G	1.219	0.66
70_S	73_S	1.207	0.65
70_S	74_G	1.187	0.64
18_A	60_G	1.182	0.63
71_L	75_G	1.170	0.62
61_S	66_A	1.129	0.60
35_V	57_S	1.122	0.59
45_F	49_I	1.119	0.59
73_S	80_G	1.115	0.59
2_Y	5_C	1.104	0.58
49_I	54_P	1.102	0.58
73_S	82_S	1.100	0.58
76_V	88_L	1.098	0.57
34_V	52_S	1.094	0.57
19_N	62_S	1.085	0.57
86_G	91_Y	1.071	0.56
47_G	55_Q	1.060	0.55
78_G	87_G	1.060	0.55
33_T	37_Q	1.039	0.53
63_G	86_G	1.031	0.53
45_F	57_S	0.978	0.49
73_S	79_S	0.976	0.49
84_G	90_G	0.975	0.49
14_P	68_G	0.974	0.49
86_G	90_G	0.937	0.46
30_P	63_G	0.921	0.45
2_Y	6_L	0.919	0.45
74_G	78_G	0.897	0.43
37_Q	45_F	0.894	0.43
28_Q	36_I	0.890	0.42
78_G	81_G	0.886	0.42
11_V	44_T	0.881	0.42
69_S	79_S	0.876	0.42
38_P	65_A	0.864	0.41
83_F	89_G	0.861	0.40
22_N	62_S	0.852	0.40
3_S	11_V	0.843	0.39
72_G	77_P	0.842	0.39
88_L	91_Y	0.826	0.38
12_C	15_Q	0.820	0.38
85_Y	88_L	0.814	0.37
4_L	54_P	0.802	0.36
77_P	89_G	0.780	0.35
85_Y	90_G	0.771	0.34
24_P	30_P	0.771	0.34
71_L	80_G	0.756	0.33
76_V	82_S	0.743	0.33
4_L	8_P	0.732	0.32
28_Q	45_F	0.727	0.32
79_S	84_G	0.726	0.32
82_S	91_Y	0.718	0.31
38_P	63_G	0.714	0.31
13_C	56_E	0.712	0.31
78_G	92_G	0.711	0.31
20_S	38_P	0.707	0.30
5_C	52_S	0.697	0.30
39_P	61_S	0.696	0.30
10_G	30_P	0.687	0.29
31_D	47_G	0.672	0.28
13_C	17_L	0.665	0.28
24_P	43_V	0.664	0.28
86_G	92_G	0.659	0.27
53_F	64_S	0.658	0.27
79_S	82_S	0.657	0.27
21_C	45_F	0.655	0.27
13_C	58_V	0.655	0.27
13_C	34_V	0.650	0.27
23_E	69_S	0.643	0.27
82_S	85_Y	0.637	0.26
72_G	78_G	0.631	0.26
17_L	52_S	0.626	0.26
26_V	50_L	0.622	0.25
82_S	87_G	0.617	0.25
74_G	83_F	0.608	0.25
84_G	88_L	0.602	0.24
82_S	90_G	0.599	0.24
15_Q	39_P	0.597	0.24
27_R	30_P	0.590	0.24
40_P	56_E	0.590	0.24
9_C	26_V	0.590	0.24
36_I	65_A	0.582	0.23
71_L	76_V	0.568	0.23
50_L	73_S	0.566	0.22
39_P	50_L	0.563	0.22
27_R	35_V	0.561	0.22
36_I	43_V	0.547	0.22
9_C	24_P	0.545	0.21
70_S	77_P	0.544	0.21
61_S	80_G	0.544	0.21
75_G	88_L	0.543	0.21
27_R	38_P	0.540	0.21
2_Y	7_P	0.539	0.21
53_F	57_S	0.533	0.21
2_Y	13_C	0.531	0.21
61_S	65_A	0.526	0.21
70_S	78_G	0.518	0.20
65_A	72_G	0.517	0.20
77_P	83_F	0.511	0.20
56_E	73_S	0.506	0.20
15_Q	34_V	0.505	0.20
36_I	63_G	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zpxA	1	0.1684	4.4	0.945	Contact Map
1l6jA	1	0.4	3.9	0.946	Contact Map
2nx7A	1	0.1789	3.6	0.947	Contact Map
4ladB	1	0.3263	2.7	0.95	Contact Map
2hm3A	1	0.2105	2.1	0.953	Contact Map
2nx6A	1	0.1684	1.9	0.954	Contact Map
4dpvZ	8	0.2737	1.9	0.954	Contact Map
1eaiC	1	0.5053	1.7	0.955	Contact Map
1wqcA	1	0.1895	1.7	0.955	Contact Map
1jfnA	1	0.4526	1.6	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.