Chromate_transp - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Chromate_transp - Chromate transporter

PFAM:	PF02417	Sequences: LELFLFFLKLGLLSFGGGYAVLPLMQRELVERRGWLTEEEFLDGLALAQLTPGPLAIQLATFIGYAGVLGALVATLGFFLPSFLLVLALAPLYERFRGNPWVQAALYGIKAAVVGLIAAAALRLARSALIAAAAFVALLFFKVPPILVILAAGLAGL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	157 (155)
Sequences:	61645 (34764)
Seq/√Len:	2792.3
META:	0.865

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_Q	38_E	5.237	1.00
27_R	31_E	3.705	1.00
4_F	77_G	3.267	1.00
37_T	40_E	3.240	1.00
28_E	32_R	3.018	1.00
40_E	66_A	2.640	1.00
2_E	33_R	2.400	1.00
61_T	75_T	2.369	1.00
44_G	62_F	2.303	1.00
26_Q	31_E	2.255	1.00
5_L	9_K	2.241	1.00
27_R	32_R	2.204	1.00
9_K	28_E	2.159	1.00
144_P	147_L	2.140	1.00
136_V	140_F	2.084	1.00
36_L	63_I	1.955	1.00
7_F	29_L	1.954	1.00
135_F	139_L	1.929	1.00
6_F	28_E	1.880	1.00
8_L	12_L	1.861	1.00
65_Y	71_A	1.859	1.00
4_F	80_L	1.830	1.00
73_V	77_G	1.775	1.00
39_E	43_D	1.732	1.00
115_G	119_A	1.720	1.00
4_F	73_V	1.703	1.00
26_Q	123_R	1.668	1.00
131_A	135_F	1.580	1.00
28_E	33_R	1.540	1.00
137_A	141_F	1.524	1.00
6_F	33_R	1.494	1.00
103_Q	107_Y	1.406	1.00
14_S	21_V	1.366	1.00
38_E	127_S	1.362	1.00
61_T	71_A	1.346	1.00
99_N	102_V	1.313	1.00
31_E	38_E	1.312	1.00
119_A	123_R	1.305	1.00
13_L	24_L	1.297	1.00
25_M	29_L	1.293	1.00
3_L	74_A	1.287	1.00
21_V	56_A	1.272	1.00
6_F	29_L	1.259	1.00
130_I	134_A	1.242	1.00
25_M	60_A	1.240	1.00
100_P	104_A	1.226	1.00
9_K	13_L	1.214	1.00
130_I	141_F	1.204	1.00
151_A	155_A	1.194	1.00
132_A	136_V	1.190	1.00
92_L	96_F	1.163	1.00
44_G	59_L	1.158	1.00
6_F	10_L	1.138	1.00
38_E	42_L	1.111	1.00
150_L	153_G	1.111	1.00
29_L	63_I	1.110	1.00
97_R	103_Q	1.107	1.00
5_L	8_L	1.096	1.00
147_L	151_A	1.095	1.00
48_A	59_L	1.091	1.00
29_L	35_W	1.073	1.00
104_A	108_G	1.071	1.00
98_G	103_Q	1.058	1.00
105_A	109_I	1.056	1.00
10_L	25_M	1.049	1.00
18_G	21_V	1.046	1.00
146_I	150_L	1.040	1.00
122_L	126_R	1.027	1.00
6_F	35_W	1.025	1.00
138_L	148_V	1.018	1.00
136_V	141_F	1.015	1.00
137_A	143_V	1.014	1.00
64_G	74_A	1.006	1.00
150_L	154_L	1.003	1.00
68_V	72_L	0.982	1.00
84_L	88_A	0.980	1.00
94_E	97_R	0.976	1.00
4_F	8_L	0.973	1.00
72_L	76_L	0.972	1.00
83_F	87_L	0.972	1.00
131_A	138_L	0.970	1.00
101_W	105_A	0.948	1.00
8_L	11_G	0.942	1.00
31_E	34_G	0.939	1.00
96_F	99_N	0.930	1.00
60_A	78_F	0.928	1.00
40_E	43_D	0.921	1.00
134_A	148_V	0.920	1.00
80_L	84_L	0.919	1.00
143_V	147_L	0.919	1.00
64_G	70_G	0.918	1.00
130_I	133_A	0.914	1.00
102_V	105_A	0.904	1.00
3_L	7_F	0.890	1.00
69_L	72_L	0.882	1.00
95_R	99_N	0.876	1.00
121_A	125_A	0.871	1.00
134_A	152_A	0.868	1.00
101_W	104_A	0.867	1.00
6_F	9_K	0.865	1.00
91_P	95_R	0.860	1.00
122_L	125_A	0.845	1.00
128_A	132_A	0.844	1.00
100_P	103_Q	0.842	1.00
18_G	58_Q	0.840	1.00
11_G	82_S	0.839	1.00
143_V	148_V	0.836	1.00
69_L	73_V	0.835	1.00
92_L	95_R	0.828	1.00
56_A	78_F	0.828	1.00
119_A	122_L	0.826	1.00
111_A	115_G	0.826	1.00
147_L	150_L	0.822	1.00
2_E	6_F	0.813	1.00
96_F	102_V	0.813	1.00
70_G	77_G	0.812	1.00
123_R	126_R	0.802	1.00
30_V	41_F	0.800	1.00
148_V	152_A	0.798	1.00
7_F	60_A	0.798	1.00
123_R	127_S	0.795	1.00
138_L	141_F	0.793	1.00
120_A	124_L	0.788	1.00
137_A	140_F	0.783	1.00
55_L	59_L	0.782	1.00
48_A	55_L	0.780	1.00
22_L	41_F	0.778	1.00
128_A	131_A	0.773	1.00
133_A	137_A	0.769	1.00
67_G	70_G	0.767	1.00
45_L	59_L	0.764	1.00
29_L	33_R	0.763	1.00
76_L	80_L	0.762	1.00
89_L	92_L	0.756	1.00
2_E	5_L	0.755	1.00
8_L	80_L	0.748	1.00
95_R	98_G	0.748	1.00
12_L	85_L	0.742	1.00
129_L	141_F	0.742	1.00
87_L	91_P	0.741	1.00
129_L	133_A	0.737	1.00
108_G	112_A	0.733	1.00
130_I	138_L	0.730	1.00
3_L	73_V	0.723	1.00
42_L	124_L	0.723	1.00
89_L	93_Y	0.722	1.00
75_T	79_F	0.718	1.00
10_L	28_E	0.718	1.00
44_G	47_L	0.712	1.00
29_L	36_L	0.712	1.00
82_S	85_L	0.712	1.00
86_V	90_A	0.709	1.00
84_L	87_L	0.707	1.00
131_A	139_L	0.704	1.00
133_A	140_F	0.704	1.00
65_Y	68_V	0.700	1.00
48_A	58_Q	0.700	1.00
99_N	103_Q	0.698	1.00
88_A	92_L	0.695	1.00
134_A	138_L	0.695	1.00
135_F	138_L	0.692	1.00
57_I	79_F	0.690	1.00
136_V	139_L	0.689	1.00
7_F	74_A	0.681	1.00
111_A	119_A	0.671	1.00
41_F	45_L	0.669	1.00
74_A	77_G	0.667	1.00
133_A	141_F	0.667	1.00
80_L	83_F	0.667	1.00
10_L	13_L	0.666	1.00
103_Q	110_K	0.662	1.00
8_L	77_G	0.659	1.00
130_I	135_F	0.659	1.00
105_A	108_G	0.658	1.00
14_S	20_A	0.656	1.00
151_A	154_L	0.651	1.00
129_L	132_A	0.642	1.00
68_V	71_A	0.642	1.00
117_I	121_A	0.633	1.00
113_V	116_L	0.631	1.00
94_E	98_G	0.627	1.00
104_A	107_Y	0.625	1.00
130_I	140_F	0.623	1.00
18_G	54_P	0.622	1.00
22_L	45_L	0.621	1.00
91_P	94_E	0.614	1.00
57_I	61_T	0.614	1.00
131_A	134_A	0.612	1.00
47_L	51_T	0.609	1.00
152_A	156_G	0.605	1.00
11_G	78_F	0.602	1.00
107_Y	111_A	0.599	1.00
26_Q	42_L	0.598	1.00
120_A	123_R	0.598	1.00
21_V	78_F	0.592	1.00
11_G	24_L	0.591	1.00
41_F	59_L	0.585	1.00
143_V	151_A	0.584	1.00
107_Y	110_K	0.578	1.00
132_A	140_F	0.576	1.00
93_Y	102_V	0.574	1.00
7_F	11_G	0.574	1.00
85_L	88_A	0.571	1.00
45_L	54_P	0.570	1.00
132_A	135_F	0.570	1.00
90_A	94_E	0.569	1.00
48_A	51_T	0.567	1.00
55_L	62_F	0.563	1.00
135_F	141_F	0.561	1.00
66_A	69_L	0.560	1.00
70_G	74_A	0.556	1.00
142_K	145_P	0.555	1.00
19_Y	55_L	0.551	1.00
10_L	24_L	0.551	1.00
146_I	149_I	0.549	1.00
55_L	58_Q	0.547	1.00
22_L	59_L	0.546	1.00
3_L	70_G	0.533	1.00
145_P	149_I	0.529	1.00
134_A	141_F	0.526	1.00
58_Q	75_T	0.526	1.00
49_Q	55_L	0.522	1.00
85_L	89_L	0.520	1.00
55_L	145_P	0.514	1.00
21_V	57_I	0.514	1.00
137_A	148_V	0.512	1.00
54_P	57_I	0.512	1.00
59_L	63_I	0.506	1.00
36_L	40_E	0.506	1.00
44_G	48_A	0.505	1.00
131_A	141_F	0.504	1.00
135_F	140_F	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2h3oA	1	0.2803	8.8	0.931	Contact Map
2mnsA	1	0.1274	6.8	0.935	Contact Map
2l8sA	1	0.1274	3.2	0.944	Contact Map
2kncA	1	0.1465	1.7	0.952	Contact Map
2xf7A	3	0.3121	1.5	0.953	Contact Map
2m3eA	1	0.1465	1.5	0.953	Contact Map
2i68A	2	0.0955	1.4	0.954	Contact Map
4d2jA	4	0.2994	1.4	0.954	Contact Map
2diiA	1	0.2229	1.3	0.955	Contact Map
2nwlA	3	0.3503	1.3	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.