Bac_transf - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Bac_transf - Bacterial sugar transferase

PFAM:	PF02397	Sequences: KRLFDIVLSLLGLILLSPLLLLIALAIKLDSPGPVFFRQERVGLNGRPFTIYKFRTMDPRITRVGRFLRKTSLDELPQLWNVLKGDMSLVGPRPELPEEELYEEERRRLSVKPGITGWAQVNGRVELDLYYIENWSLWLDLKILLKTVPVVLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	153 (152)
Sequences:	100333 (62772)
Seq/√Len:	5091.5
META:	0.881

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
2_R	6_I	3.559	1.00
40_E	48_P	3.371	1.00
40_E	50_T	3.249	1.00
130_Y	134_N	3.238	1.00
38_R	50_T	3.046	1.00
26_A	64_V	2.565	1.00
95_E	99_E	2.376	1.00
28_K	33_G	2.345	1.00
67_F	71_T	2.181	1.00
30_D	63_R	2.180	1.00
43_G	113_P	2.133	1.00
23_I	73_L	2.124	1.00
38_R	52_Y	2.109	1.00
118_W	122_N	1.916	1.00
23_I	54_F	1.885	1.00
142_K	146_K	1.854	1.00
118_W	130_Y	1.829	1.00
48_P	97_P	1.743	1.00
52_Y	81_N	1.692	1.00
102_Y	105_E	1.612	1.00
119_A	124_R	1.602	1.00
117_G	120_Q	1.596	1.00
9_S	14_I	1.595	1.00
107_R	133_E	1.582	1.00
24_A	35_V	1.537	1.00
96_L	99_E	1.536	1.00
28_K	35_V	1.516	1.00
5_D	88_S	1.508	1.00
80_W	84_K	1.497	1.00
4_F	8_L	1.483	1.00
130_Y	139_L	1.454	1.00
14_I	17_S	1.424	1.00
18_P	21_L	1.404	1.00
107_R	110_S	1.402	1.00
117_G	124_R	1.392	1.00
20_L	54_F	1.378	1.00
10_L	83_L	1.376	1.00
23_I	68_L	1.353	1.00
122_N	146_K	1.350	1.00
81_N	86_D	1.350	1.00
27_I	31_S	1.293	1.00
36_F	52_Y	1.290	1.00
9_S	13_L	1.289	1.00
90_V	144_L	1.274	1.00
13_L	80_W	1.274	1.00
111_V	132_I	1.265	1.00
42_V	48_P	1.261	1.00
16_L	20_L	1.258	1.00
138_W	142_K	1.257	1.00
9_S	83_L	1.234	1.00
42_V	97_P	1.233	1.00
12_G	16_L	1.231	1.00
118_W	139_L	1.231	1.00
116_T	147_T	1.198	1.00
8_L	89_L	1.189	1.00
1_K	140_D	1.182	1.00
118_W	143_I	1.181	1.00
82_V	115_I	1.163	1.00
52_Y	80_W	1.155	1.00
45_N	110_S	1.146	1.00
6_I	10_L	1.138	1.00
30_D	64_V	1.134	1.00
22_L	26_A	1.134	1.00
118_W	127_L	1.131	1.00
95_E	124_R	1.130	1.00
44_L	112_K	1.127	1.00
28_K	31_S	1.112	1.00
39_Q	51_I	1.103	1.00
95_E	102_Y	1.094	1.00
26_A	30_D	1.092	1.00
131_Y	140_D	1.062	1.00
68_L	71_T	1.061	1.00
103_E	106_R	1.060	1.00
117_G	128_D	1.053	1.00
8_L	12_G	1.046	1.00
17_S	20_L	1.035	1.00
34_P	55_R	1.022	1.00
122_N	127_L	1.022	1.00
146_K	150_V	1.020	1.00
17_S	21_L	1.019	1.00
6_I	9_S	1.017	1.00
25_L	29_L	1.015	1.00
134_N	139_L	1.010	1.00
100_E	106_R	1.001	1.00
10_L	14_I	0.992	1.00
30_D	62_T	0.991	1.00
46_G	109_L	0.991	1.00
52_Y	84_K	0.987	1.00
56_T	68_L	0.966	1.00
1_K	88_S	0.960	1.00
90_V	116_T	0.952	1.00
137_L	141_L	0.949	1.00
146_K	149_P	0.930	1.00
13_L	17_S	0.925	1.00
120_Q	128_D	0.920	1.00
12_G	79_L	0.903	1.00
79_L	89_L	0.902	1.00
105_E	126_E	0.895	1.00
15_L	18_P	0.894	1.00
145_L	149_P	0.894	1.00
1_K	5_D	0.892	1.00
61_I	69_R	0.892	1.00
61_I	66_R	0.889	1.00
24_A	27_I	0.878	1.00
136_S	139_L	0.877	1.00
24_A	28_K	0.870	1.00
14_I	18_P	0.867	1.00
139_L	142_K	0.860	1.00
82_V	89_L	0.860	1.00
12_G	89_L	0.857	1.00
72_S	150_V	0.857	1.00
1_K	135_W	0.843	1.00
39_Q	96_L	0.841	1.00
40_E	97_P	0.838	1.00
4_F	137_L	0.826	1.00
20_L	80_W	0.822	1.00
21_L	25_L	0.812	1.00
20_L	76_L	0.811	1.00
49_F	87_M	0.807	1.00
27_I	54_F	0.805	1.00
19_L	23_I	0.802	1.00
42_V	109_L	0.799	1.00
57_M	60_R	0.789	1.00
92_P	111_V	0.786	1.00
72_S	123_G	0.781	1.00
31_S	64_V	0.779	1.00
95_E	98_E	0.778	1.00
129_L	132_I	0.777	1.00
38_R	51_I	0.776	1.00
8_L	11_L	0.771	1.00
18_P	22_L	0.769	1.00
129_L	133_E	0.769	1.00
46_G	106_R	0.762	1.00
122_N	130_Y	0.760	1.00
95_E	109_L	0.759	1.00
108_R	124_R	0.755	1.00
55_R	74_D	0.750	1.00
121_V	146_K	0.747	1.00
35_V	54_F	0.746	1.00
95_E	119_A	0.746	1.00
28_K	32_P	0.745	1.00
64_V	68_L	0.742	1.00
132_I	135_W	0.740	1.00
99_E	119_A	0.737	1.00
135_W	139_L	0.731	1.00
13_L	20_L	0.731	1.00
89_L	144_L	0.730	1.00
28_K	34_P	0.728	1.00
9_S	16_L	0.718	1.00
95_E	125_V	0.713	1.00
27_I	30_D	0.712	1.00
101_L	105_E	0.705	1.00
119_A	123_G	0.701	1.00
62_T	65_G	0.701	1.00
42_V	96_L	0.701	1.00
23_I	26_A	0.693	1.00
26_A	29_L	0.692	1.00
66_R	70_K	0.690	1.00
100_E	105_E	0.689	1.00
6_I	11_L	0.688	1.00
40_E	98_E	0.684	1.00
37_F	96_L	0.679	1.00
7_V	10_L	0.676	1.00
97_P	100_E	0.676	1.00
72_S	151_V	0.673	1.00
56_T	69_R	0.668	1.00
27_I	55_R	0.658	1.00
108_R	129_L	0.657	1.00
63_R	66_R	0.648	1.00
23_I	64_V	0.647	1.00
21_L	24_A	0.644	1.00
27_I	35_V	0.640	1.00
118_W	134_N	0.640	1.00
16_L	23_I	0.638	1.00
80_W	86_D	0.636	1.00
107_R	129_L	0.629	1.00
110_S	133_E	0.627	1.00
99_E	124_R	0.626	1.00
95_E	108_R	0.623	1.00
125_V	129_L	0.623	1.00
126_E	130_Y	0.619	1.00
100_E	103_E	0.615	1.00
149_P	152_L	0.610	1.00
53_K	75_E	0.609	1.00
13_L	83_L	0.605	1.00
121_V	150_V	0.605	1.00
148_V	151_V	0.605	1.00
11_L	14_I	0.603	1.00
4_F	141_L	0.602	1.00
120_Q	123_G	0.602	1.00
41_R	51_I	0.590	1.00
117_G	125_V	0.588	1.00
7_V	11_L	0.587	1.00
111_V	135_W	0.584	1.00
135_W	138_W	0.584	1.00
3_L	7_V	0.581	1.00
16_L	19_L	0.578	1.00
25_L	28_K	0.566	1.00
24_A	54_F	0.563	1.00
42_V	95_E	0.558	1.00
81_N	84_K	0.556	1.00
145_L	148_V	0.555	1.00
12_G	15_L	0.552	1.00
9_S	89_L	0.551	1.00
141_L	145_L	0.548	1.00
3_L	6_I	0.546	1.00
105_E	129_L	0.544	1.00
144_L	148_V	0.544	1.00
27_I	64_V	0.541	1.00
42_V	99_E	0.540	1.00
6_I	83_L	0.538	1.00
20_L	23_I	0.537	1.00
41_R	94_P	0.536	1.00
13_L	16_L	0.531	1.00
95_E	100_E	0.530	1.00
124_R	129_L	0.527	1.00
44_L	111_V	0.524	1.00
31_S	34_P	0.524	1.00
100_E	104_E	0.523	1.00
142_K	149_P	0.522	1.00
9_S	12_G	0.514	1.00
44_L	47_R	0.513	1.00
138_W	141_L	0.513	1.00
67_F	73_L	0.509	1.00
31_S	55_R	0.505	1.00
57_M	61_I	0.503	1.00
118_W	128_D	0.503	1.00
42_V	49_F	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4c48C	1	0.3007	3	0.95	Contact Map
4ioyX	1	0.3268	1.9	0.955	Contact Map
1jb0F	1	0.7386	1.8	0.956	Contact Map
4g7vS	1	0.2353	1.7	0.957	Contact Map
4kt0F	1	0.719	1.4	0.959	Contact Map
1xkmA	2	0.1438	1.3	0.959	Contact Map
2k44A	1	0.1765	1.3	0.96	Contact Map
4w8pB	1	0.1373	1.2	0.96	Contact Map
1uptB	2	0.1961	1.2	0.961	Contact Map
1zzaA	1	0.5033	1.1	0.961	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.