MgtC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MgtC - MgtC family

PFAM:	PF02308	Sequences: LLLALLLGGLIGLERERRGKPAGLRTFALVALGAALFTLLSIYLFGSRVAAGVVTGIGFLGAGAILRYRRGGSVRGLTTAAALWVTAAIGLAAGAGLYLLAVAATVLVLLVLALLRPLERW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	121 (118)
Sequences:	35594 (22587)
Seq/√Len:	2079.3
META:	0.902

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_G	31_A	3.475	1.00
85_V	108_V	3.430	1.00
30_V	83_L	2.902	1.00
36_L	104_A	2.611	1.00
11_I	86_T	2.588	1.00
31_A	86_T	2.550	1.00
93_A	101_A	2.488	1.00
37_F	88_A	2.423	1.00
28_A	111_V	2.384	1.00
38_T	91_L	2.302	1.00
7_L	105_T	2.230	1.00
7_L	93_A	2.102	1.00
97_L	100_L	2.093	1.00
52_G	55_T	1.915	1.00
35_A	93_A	1.870	1.00
27_F	82_A	1.858	1.00
4_A	35_A	1.774	1.00
5_L	28_A	1.615	1.00
3_L	93_A	1.521	1.00
27_F	86_T	1.443	1.00
92_A	101_A	1.432	1.00
31_A	35_A	1.388	1.00
9_G	28_A	1.373	1.00
38_T	95_A	1.370	1.00
35_A	94_G	1.366	1.00
26_T	81_A	1.366	1.00
65_I	68_Y	1.357	1.00
33_G	84_W	1.354	1.00
114_L	117_P	1.350	1.00
27_F	79_T	1.346	1.00
82_A	112_L	1.340	1.00
30_V	87_A	1.336	1.00
9_G	24_L	1.311	1.00
38_T	42_I	1.310	1.00
50_A	91_L	1.308	1.00
7_L	89_I	1.262	1.00
57_I	87_A	1.247	1.00
63_G	68_Y	1.229	1.00
5_L	32_L	1.215	1.00
13_L	17_R	1.210	1.00
6_L	9_G	1.207	1.00
38_T	94_G	1.172	1.00
29_L	108_V	1.168	1.00
33_G	85_V	1.161	1.00
110_L	114_L	1.136	1.00
37_F	54_V	1.130	1.00
4_A	8_G	1.122	1.00
66_L	69_R	1.117	1.00
11_I	108_V	1.114	1.00
43_Y	46_G	1.113	1.00
89_I	105_T	1.109	1.00
22_A	27_F	1.102	1.00
48_R	52_G	1.101	1.00
7_L	101_A	1.085	1.00
43_Y	97_L	1.078	1.00
68_Y	72_G	1.063	1.00
24_L	28_A	1.060	1.00
2_L	6_L	1.056	1.00
30_V	81_A	1.049	1.00
36_L	88_A	1.045	1.00
3_L	7_L	1.033	1.00
7_L	102_V	1.020	1.00
40_L	92_A	1.015	1.00
29_L	85_V	1.008	1.00
53_V	56_G	1.007	1.00
3_L	98_Y	1.006	1.00
34_A	87_A	1.005	1.00
4_A	31_A	1.001	1.00
31_A	93_A	0.998	1.00
5_L	111_V	0.998	1.00
14_E	18_R	0.995	1.00
51_A	55_T	0.990	1.00
69_R	72_G	0.983	1.00
36_L	92_A	0.971	1.00
10_L	109_L	0.949	1.00
63_G	66_L	0.926	1.00
98_Y	102_V	0.910	1.00
53_V	57_I	0.903	1.00
40_L	95_A	0.895	1.00
76_G	79_T	0.891	1.00
76_G	80_A	0.888	1.00
115_L	119_E	0.881	1.00
62_A	65_I	0.880	1.00
33_G	88_A	0.859	1.00
14_E	113_A	0.853	1.00
99_L	102_V	0.830	1.00
105_T	109_L	0.829	1.00
64_A	68_Y	0.822	1.00
53_V	91_L	0.820	1.00
68_Y	71_G	0.818	1.00
111_V	115_L	0.815	1.00
108_V	112_L	0.808	1.00
103_A	106_V	0.806	1.00
5_L	107_L	0.801	1.00
48_R	51_A	0.789	1.00
33_G	37_F	0.774	1.00
35_A	39_L	0.772	1.00
62_A	66_L	0.770	1.00
48_R	59_F	0.760	1.00
78_T	112_L	0.758	1.00
21_P	77_L	0.757	1.00
47_S	51_A	0.755	1.00
99_L	103_A	0.754	1.00
51_A	54_V	0.753	1.00
102_V	105_T	0.751	1.00
18_R	116_R	0.736	1.00
50_A	54_V	0.734	1.00
42_I	46_G	0.734	1.00
56_G	60_L	0.730	1.00
24_L	115_L	0.723	1.00
89_I	104_A	0.718	1.00
20_K	75_R	0.718	1.00
47_S	52_G	0.712	1.00
65_I	69_R	0.709	1.00
2_L	107_L	0.701	1.00
40_L	91_L	0.696	1.00
70_R	75_R	0.692	1.00
32_L	85_V	0.691	1.00
27_F	83_L	0.686	1.00
113_A	117_P	0.680	1.00
54_V	57_I	0.674	1.00
11_I	82_A	0.669	1.00
89_I	108_V	0.669	1.00
23_G	26_T	0.667	1.00
70_R	73_S	0.649	1.00
40_L	97_L	0.642	1.00
89_I	101_A	0.642	1.00
44_L	95_A	0.635	1.00
104_A	108_V	0.618	1.00
60_L	65_I	0.617	1.00
27_F	31_A	0.616	1.00
109_L	113_A	0.615	1.00
92_A	100_L	0.608	1.00
58_G	61_G	0.608	1.00
57_I	61_G	0.605	1.00
59_F	63_G	0.598	1.00
39_L	43_Y	0.597	1.00
39_L	100_L	0.596	1.00
53_V	87_A	0.592	1.00
69_R	73_S	0.586	1.00
38_T	50_A	0.584	1.00
8_G	28_A	0.580	1.00
18_R	113_A	0.569	1.00
29_L	33_G	0.568	1.00
37_F	91_L	0.565	1.00
50_A	53_V	0.563	1.00
22_A	26_T	0.562	1.00
51_A	59_F	0.562	1.00
64_A	69_R	0.561	1.00
28_A	115_L	0.561	1.00
24_L	118_L	0.559	1.00
48_R	56_G	0.557	1.00
14_E	79_T	0.554	1.00
42_I	95_A	0.551	1.00
74_V	80_A	0.551	1.00
17_R	113_A	0.550	1.00
26_T	78_T	0.549	1.00
55_T	59_F	0.548	1.00
16_E	24_L	0.546	1.00
14_E	17_R	0.546	1.00
61_G	65_I	0.544	1.00
29_L	81_A	0.540	1.00
103_A	107_L	0.540	1.00
43_Y	100_L	0.536	1.00
101_A	105_T	0.533	1.00
33_G	87_A	0.529	1.00
85_V	89_I	0.526	1.00
37_F	87_A	0.519	1.00
106_V	113_A	0.518	1.00
77_L	80_A	0.510	1.00
52_G	56_G	0.506	1.00
40_L	44_L	0.504	1.00
106_V	110_L	0.503	1.00
41_S	49_V	0.501	1.00
41_S	44_L	0.501	1.00
63_G	69_R	0.501	1.00
55_T	58_G	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3giaA	1	0.9917	6	0.913	Contact Map
4huqS	1	0.7438	4.5	0.918	Contact Map
3hd6A	3	0.9587	4.4	0.919	Contact Map
1u7gA	3	0.9339	3.6	0.922	Contact Map
2b2hA	3	0.9339	3.5	0.923	Contact Map
4n7wA	2	0.6033	3.4	0.923	Contact Map
4j05A	3	0.8926	3.3	0.924	Contact Map
3l1lA	2	0.6281	3.1	0.925	Contact Map
3iyzA	3	0.9174	2.4	0.929	Contact Map
3wajA	1	0.9835	2	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.