DUF131 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF131 - Protein of unknown function DUF131

PFAM:	PF01998	Sequences: IGTILQMRKEEESEEEEEKTKVKGGGVIMIGPIPIVFGSDKKSAKIALILAIILMILALLLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	62 (49)
Sequences:	731 (592)
Seq/√Len:	84.5
META:	0.884

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_K	40_D	4.940	1.00
26_G	37_F	3.619	1.00
43_S	47_A	3.074	1.00
40_D	43_S	2.117	1.00
39_S	44_A	2.015	1.00
24_G	39_S	1.892	1.00
54_L	58_A	1.746	1.00
25_G	49_I	1.651	1.00
55_M	58_A	1.639	1.00
25_G	39_S	1.534	1.00
27_V	51_A	1.451	0.99
29_M	51_A	1.424	0.99
26_G	36_V	1.311	0.99
36_V	48_L	1.219	0.98
29_M	55_M	1.212	0.98
27_V	44_A	1.210	0.98
36_V	51_A	1.203	0.97
15_E	21_K	1.201	0.97
39_S	43_S	1.189	0.97
14_E	17_E	1.185	0.97
28_I	37_F	1.183	0.97
36_V	44_A	1.166	0.97
27_V	47_A	1.101	0.96
23_K	42_K	1.080	0.95
35_I	48_L	0.957	0.91
15_E	60_L	0.951	0.91
28_I	41_K	0.950	0.91
48_L	58_A	0.896	0.88
40_D	46_I	0.884	0.87
15_E	49_I	0.861	0.86
14_E	56_I	0.782	0.80
16_E	19_K	0.780	0.80
26_G	35_I	0.763	0.79
13_S	53_I	0.760	0.78
23_K	39_S	0.737	0.76
55_M	61_L	0.732	0.76
46_I	58_A	0.716	0.74
21_K	57_L	0.703	0.73
39_S	47_A	0.702	0.73
45_K	48_L	0.684	0.71
38_G	47_A	0.677	0.70
14_E	20_T	0.670	0.69
18_E	59_L	0.670	0.69
55_M	59_L	0.651	0.67
46_I	49_I	0.636	0.65
25_G	40_D	0.634	0.65
29_M	45_K	0.634	0.65
14_E	18_E	0.633	0.65
18_E	53_I	0.632	0.65
29_M	50_L	0.632	0.65
16_E	21_K	0.626	0.64
25_G	35_I	0.617	0.63
50_L	54_L	0.613	0.62
46_I	55_M	0.601	0.61
19_K	45_K	0.600	0.61
39_S	42_K	0.596	0.60
27_V	49_I	0.594	0.60
19_K	41_K	0.591	0.59
31_G	34_P	0.586	0.59
26_G	32_P	0.562	0.56
57_L	60_L	0.560	0.55
13_S	18_E	0.541	0.53
48_L	51_A	0.537	0.52
16_E	22_V	0.536	0.52
38_G	44_A	0.532	0.52
17_E	57_L	0.524	0.51
17_E	41_K	0.522	0.50
33_I	59_L	0.521	0.50
15_E	19_K	0.515	0.49
33_I	61_L	0.514	0.49
14_E	19_K	0.510	0.49
26_G	59_L	0.506	0.48
28_I	35_I	0.506	0.48
17_E	20_T	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2e84A	1	0	9.1	0.857	Contact Map
1z1nX	1	0	7.4	0.862	Contact Map
3mk7C	2	0.9032	7.3	0.862	Contact Map
2cvcA	1	0	3.8	0.88	Contact Map
4he8J	1	0.1613	3.2	0.884	Contact Map
3qnqA	2	0.9516	3	0.885	Contact Map
3j6dA	3	0	2	0.895	Contact Map
2j7aC	2	0.2742	2	0.896	Contact Map
4xtrG	1	0.2903	2	0.897	Contact Map
4rp9A	2	0.2742	1.8	0.898	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0041 seconds.