MNHE - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MNHE - Na+/H+ ion antiporter subunit

PFAM:	PF01899	Sequences: FLLLFLLWLLLSGSPGNLLLGLVLALLVALLSRRLLLPPRRLPLRLLRYLLWFLWEIVKANLDVARRVLSPRLPIRPGIVRVPLDLKSDLGITLLANSITLTPGTLTVDVDDDRGTLYVHALDVDDDPEAAIREIKGRFERRLLEI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	146 (142)
Sequences:	17316 (12879)
Seq/√Len:	1080.8
META:	0.826

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
49_Y	98_S	3.763	1.00
63_D	67_R	3.019	1.00
55_W	59_K	2.959	1.00
66_R	70_S	2.951	1.00
81_R	116_T	2.938	1.00
81_R	118_Y	2.813	1.00
5_F	25_A	2.564	1.00
78_G	124_V	2.522	1.00
39_P	42_L	2.369	1.00
88_S	91_G	2.277	1.00
79_I	108_V	2.180	1.00
70_S	74_P	2.110	1.00
133_R	137_G	2.081	1.00
70_S	73_L	2.055	1.00
56_E	59_K	1.969	1.00
47_L	51_L	1.916	1.00
51_L	55_W	1.908	1.00
107_T	117_L	1.876	1.00
53_F	57_I	1.843	1.00
85_D	144_L	1.828	1.00
83_P	116_T	1.804	1.00
12_S	17_N	1.705	1.00
85_D	136_K	1.680	1.00
86_L	91_G	1.660	1.00
5_F	18_L	1.600	1.00
128_P	132_I	1.569	1.00
129_E	133_R	1.561	1.00
67_R	123_D	1.547	1.00
62_L	66_R	1.531	1.00
5_F	22_L	1.518	1.00
64_V	122_L	1.478	1.00
79_I	118_Y	1.471	1.00
16_G	20_L	1.465	1.00
38_P	41_R	1.430	1.00
96_A	107_T	1.417	1.00
44_L	48_R	1.348	1.00
67_R	122_L	1.342	1.00
48_R	142_R	1.339	1.00
136_K	140_E	1.336	1.00
52_W	56_E	1.322	1.00
81_R	114_R	1.289	1.00
37_L	40_R	1.287	1.00
82_V	136_K	1.275	1.00
131_A	134_E	1.273	1.00
130_A	134_E	1.257	1.00
63_D	66_R	1.254	1.00
138_R	142_R	1.244	1.00
129_E	132_I	1.242	1.00
59_K	63_D	1.241	1.00
19_L	23_V	1.206	1.00
48_R	51_L	1.180	1.00
45_R	48_R	1.176	1.00
92_I	115_G	1.166	1.00
82_V	117_L	1.164	1.00
76_R	124_V	1.161	1.00
17_N	20_L	1.138	1.00
80_V	121_A	1.138	1.00
9_L	18_L	1.131	1.00
53_F	98_S	1.117	1.00
38_P	42_L	1.113	1.00
52_W	55_W	1.101	1.00
132_I	136_K	1.099	1.00
48_R	52_W	1.094	1.00
14_S	17_N	1.088	1.00
87_K	115_G	1.065	1.00
130_A	133_R	1.063	1.00
76_R	123_D	1.057	1.00
53_F	101_L	1.041	1.00
52_W	142_R	1.038	1.00
65_A	69_L	1.030	1.00
32_S	36_L	1.024	1.00
137_G	141_R	1.021	1.00
111_D	114_R	1.020	1.00
90_L	94_L	1.019	1.00
121_A	124_V	1.012	1.00
25_A	29_A	1.005	1.00
109_D	118_Y	1.003	1.00
63_D	123_D	0.987	1.00
7_L	11_L	0.985	1.00
5_F	21_G	0.977	1.00
5_F	9_L	0.975	1.00
76_R	125_D	0.969	1.00
61_N	65_A	0.957	1.00
82_V	95_L	0.946	1.00
97_N	107_T	0.932	1.00
128_P	131_A	0.931	1.00
16_G	19_L	0.927	1.00
20_L	24_L	0.911	1.00
56_E	138_R	0.905	1.00
84_L	92_I	0.902	1.00
33_R	36_L	0.887	1.00
133_R	136_K	0.885	1.00
71_P	74_P	0.883	1.00
66_R	73_L	0.882	1.00
9_L	14_S	0.876	1.00
46_L	50_L	0.864	1.00
67_R	74_P	0.861	1.00
43_P	47_L	0.859	1.00
85_D	140_E	0.857	1.00
66_R	69_L	0.848	1.00
99_I	119_V	0.843	1.00
23_V	26_L	0.836	1.00
99_I	102_T	0.834	1.00
15_P	19_L	0.827	1.00
83_P	114_R	0.826	1.00
86_L	144_L	0.818	1.00
24_L	28_V	0.814	1.00
83_P	115_G	0.805	1.00
4_L	28_V	0.797	1.00
86_L	92_I	0.796	1.00
56_E	139_F	0.796	1.00
30_L	34_R	0.781	1.00
52_W	138_R	0.778	1.00
58_V	61_N	0.777	1.00
62_L	65_A	0.776	1.00
100_T	107_T	0.775	1.00
22_L	26_L	0.767	1.00
80_V	131_A	0.763	1.00
3_L	7_L	0.761	1.00
86_L	95_L	0.760	1.00
58_V	62_L	0.757	1.00
51_L	54_L	0.745	1.00
126_D	130_A	0.744	1.00
65_A	68_V	0.740	1.00
26_L	30_L	0.731	1.00
123_D	126_D	0.719	1.00
67_R	70_S	0.717	1.00
19_L	22_L	0.703	1.00
61_N	64_V	0.701	1.00
5_F	29_A	0.700	1.00
57_I	101_L	0.699	1.00
27_L	30_L	0.693	1.00
31_L	34_R	0.693	1.00
134_E	137_G	0.690	1.00
44_L	47_L	0.687	1.00
26_L	29_A	0.684	1.00
30_L	33_R	0.677	1.00
132_I	135_I	0.671	1.00
14_S	18_L	0.667	1.00
9_L	12_S	0.664	1.00
131_A	135_I	0.663	1.00
84_L	117_L	0.662	1.00
86_L	140_E	0.654	1.00
102_T	105_T	0.648	1.00
93_T	97_N	0.637	1.00
125_D	130_A	0.634	1.00
95_L	135_I	0.633	1.00
49_Y	53_F	0.631	1.00
28_V	32_S	0.631	1.00
75_I	123_D	0.630	1.00
18_L	22_L	0.626	1.00
111_D	115_G	0.623	1.00
54_L	58_V	0.620	1.00
110_V	117_L	0.619	1.00
93_T	96_A	0.619	1.00
56_E	60_A	0.614	1.00
4_L	25_A	0.613	1.00
97_N	101_L	0.611	1.00
131_A	136_K	0.610	1.00
28_V	31_L	0.608	1.00
67_R	75_I	0.606	1.00
141_R	144_L	0.606	1.00
60_A	102_T	0.605	1.00
96_A	117_L	0.604	1.00
66_R	74_P	0.600	1.00
107_T	119_V	0.598	1.00
92_I	112_D	0.594	1.00
42_L	45_R	0.594	1.00
32_S	35_L	0.593	1.00
12_S	20_L	0.593	1.00
16_G	24_L	0.592	1.00
14_S	19_L	0.592	1.00
82_V	119_V	0.591	1.00
55_W	138_R	0.585	1.00
97_N	106_L	0.583	1.00
40_R	43_P	0.582	1.00
111_D	116_T	0.580	1.00
57_I	61_N	0.580	1.00
98_S	143_L	0.579	1.00
97_N	119_V	0.575	1.00
21_G	29_A	0.573	1.00
84_L	95_L	0.566	1.00
37_L	42_L	0.565	1.00
6_L	10_L	0.562	1.00
85_D	141_R	0.560	1.00
56_E	102_T	0.560	1.00
94_L	143_L	0.556	1.00
38_P	43_P	0.555	1.00
92_I	117_L	0.555	1.00
50_L	54_L	0.554	1.00
125_D	128_P	0.543	1.00
92_I	114_R	0.543	1.00
95_L	143_L	0.539	1.00
92_I	110_V	0.539	1.00
29_A	33_R	0.539	1.00
64_V	68_V	0.537	1.00
135_I	139_F	0.533	1.00
89_D	93_T	0.531	1.00
82_V	135_I	0.530	1.00
48_R	55_W	0.529	1.00
121_A	131_A	0.527	1.00
59_K	66_R	0.524	1.00
23_V	27_L	0.524	1.00
89_D	92_I	0.523	1.00
43_P	46_L	0.519	1.00
92_I	113_D	0.518	1.00
20_L	23_V	0.518	1.00
87_K	91_G	0.516	1.00
4_L	29_A	0.513	1.00
101_L	106_L	0.508	1.00
83_P	113_D	0.506	1.00
67_R	71_P	0.505	1.00
81_R	111_D	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ookA	2	0.3151	11.1	0.912	Contact Map
1rl6A	1	0.4384	4.7	0.925	Contact Map
4tp9G	1	0.4795	4.7	0.925	Contact Map
3zf7y	1	0.5274	3.9	0.928	Contact Map
3aqpA	1	0.4589	3.9	0.928	Contact Map
4dx5A	3	0.4726	3.8	0.929	Contact Map
4pwwA	2	0.4247	3.7	0.929	Contact Map
2mgyA	1	0.5479	3.4	0.931	Contact Map
4mt1A	3	0.4315	3.2	0.931	Contact Map
4qkvA	3	0.2671	3.1	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.