WSC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

WSC - WSC domain

PFAM:	PF01822	Sequences: YLGCYTDSSGGRRLLGGSSTSSSNMTVESCAAACAAKGYTYAGLEYGGECYCGNSLPNGGAPAPDSDCNMPCSGNSSETCGG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	82 (81)
Sequences:	7213 (6085)
Seq/√Len:	676.1
META:	0.416

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_C	52_C	4.222	1.00
27_V	44_L	4.113	1.00
31_A	42_A	4.021	1.00
71_P	79_T	2.521	1.00
48_G	73_S	2.478	1.00
47_G	70_M	2.320	1.00
75_N	78_E	2.106	1.00
40_T	54_N	2.076	1.00
46_Y	49_E	2.008	1.00
27_V	78_E	2.003	1.00
24_N	29_S	1.778	1.00
33_A	37_K	1.761	1.00
28_E	78_E	1.593	1.00
39_Y	54_N	1.535	1.00
46_Y	70_M	1.510	1.00
25_M	29_S	1.492	1.00
30_C	50_C	1.457	1.00
7_D	45_E	1.424	1.00
72_C	80_C	1.414	1.00
62_P	65_D	1.392	1.00
64_P	67_D	1.370	1.00
42_A	52_C	1.353	1.00
39_Y	52_C	1.255	1.00
53_G	57_P	1.250	1.00
18_S	33_A	1.228	1.00
45_E	49_E	1.225	1.00
56_L	60_G	1.205	1.00
63_A	67_D	1.198	1.00
6_T	63_A	1.173	1.00
43_G	53_G	1.158	1.00
22_S	25_M	1.156	1.00
25_M	74_G	1.123	1.00
31_A	35_A	1.115	1.00
23_S	48_G	1.073	1.00
34_C	42_A	1.040	1.00
5_Y	62_P	1.040	1.00
71_P	76_S	1.038	1.00
13_R	16_G	1.033	1.00
2_L	5_Y	1.010	1.00
28_E	32_A	1.001	1.00
45_E	51_Y	1.000	1.00
33_A	36_A	0.987	1.00
22_S	29_S	0.952	1.00
12_R	15_L	0.932	1.00
56_L	59_G	0.928	1.00
69_N	82_G	0.911	1.00
29_S	32_A	0.907	1.00
27_V	31_A	0.904	1.00
23_S	73_S	0.874	1.00
25_M	44_L	0.865	1.00
32_A	35_A	0.864	1.00
2_L	41_Y	0.859	1.00
57_P	60_G	0.855	1.00
29_S	33_A	0.854	1.00
20_T	29_S	0.813	1.00
19_S	33_A	0.804	1.00
27_V	42_A	0.794	1.00
20_T	33_A	0.788	1.00
70_M	82_G	0.772	1.00
25_M	73_S	0.772	1.00
19_S	37_K	0.753	1.00
58_N	61_A	0.750	1.00
32_A	36_A	0.730	1.00
26_T	74_G	0.729	1.00
5_Y	56_L	0.725	1.00
7_D	46_Y	0.722	1.00
33_A	52_C	0.719	1.00
69_N	79_T	0.709	1.00
21_S	48_G	0.708	1.00
4_C	68_C	0.704	1.00
28_E	31_A	0.701	1.00
7_D	13_R	0.688	1.00
20_T	25_M	0.688	1.00
5_Y	65_D	0.686	1.00
11_G	15_L	0.685	1.00
17_G	20_T	0.675	1.00
26_T	75_N	0.660	1.00
59_G	62_P	0.650	1.00
14_L	17_G	0.649	1.00
16_G	53_G	0.649	1.00
60_G	63_A	0.639	1.00
15_L	18_S	0.635	1.00
6_T	67_D	0.633	1.00
13_R	17_G	0.632	1.00
63_A	66_S	0.632	1.00
58_N	62_P	0.631	1.00
8_S	12_R	0.627	1.00
15_L	53_G	0.626	1.00
5_Y	60_G	0.623	1.00
26_T	29_S	0.617	1.00
47_G	73_S	0.615	1.00
10_G	14_L	0.612	1.00
19_S	49_E	0.612	1.00
8_S	59_G	0.611	1.00
21_S	24_N	0.608	1.00
60_G	64_P	0.606	1.00
62_P	67_D	0.605	1.00
62_P	66_S	0.602	1.00
21_S	25_M	0.596	1.00
41_Y	56_L	0.596	1.00
71_P	77_S	0.591	1.00
76_S	79_T	0.590	1.00
18_S	37_K	0.580	1.00
12_R	16_G	0.580	1.00
17_G	33_A	0.573	1.00
41_Y	54_N	0.562	1.00
6_T	59_G	0.556	1.00
28_E	75_N	0.550	1.00
74_G	78_E	0.547	1.00
16_G	57_P	0.538	1.00
17_G	21_S	0.534	1.00
41_Y	57_P	0.534	1.00
43_G	51_Y	0.533	1.00
22_S	48_G	0.531	1.00
8_S	11_G	0.530	1.00
7_D	14_L	0.527	1.00
65_D	79_T	0.526	1.00
61_A	67_D	0.523	0.99
11_G	16_G	0.519	0.99
6_T	60_G	0.517	0.99
11_G	14_L	0.516	0.99
3_G	41_Y	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kozA	1	0.4024	6.3	0.857	Contact Map
1pz7A	1	0.4024	4.1	0.87	Contact Map
1r1gA	1	0.3049	3.7	0.873	Contact Map
2e3eA	1	0.5488	3.2	0.877	Contact Map
1d5qA	1	0.3293	2.9	0.88	Contact Map
3v64A	2	0.4024	2.8	0.881	Contact Map
2meoA	1	0.4024	2.8	0.881	Contact Map
1pnhA	1	0.378	2.7	0.881	Contact Map
1pjvA	1	0.3902	2.6	0.882	Contact Map
3pveA	1	0.3902	2.5	0.883	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.