Ferric_reduct - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Ferric_reduct - Ferric reductase like transmembrane component

PFAM:	PF01794	Sequences: TGLVALVLLLLTLLLTLRVTPLRPLRGLGLDRLLRLHRMLGLLAFFYALLHVLTYLVDDYAFDGLDLLVPFADIYKRPFITLGFVALLLLLALAVTSTDLARRLGYRRWRRLHRLVYLAAVLAV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	124 (120)
Sequences:	44235 (28946)
Seq/√Len:	2642.4
META:	0.849

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
49_L	87_L	3.698	1.00
45_F	91_L	3.289	1.00
108_R	111_R	3.074	1.00
98_T	101_A	3.057	1.00
5_A	48_A	2.794	1.00
3_L	7_V	2.543	1.00
45_F	94_A	2.484	1.00
110_R	114_R	2.346	1.00
39_M	43_L	2.244	1.00
89_L	119_A	2.165	1.00
52_V	87_L	2.140	1.00
105_G	108_R	2.125	1.00
115_L	118_L	2.045	1.00
84_F	88_L	1.940	1.00
114_R	118_L	1.904	1.00
29_G	32_R	1.764	1.00
69_V	72_A	1.737	1.00
118_L	121_V	1.555	1.00
12_T	44_A	1.523	1.00
57_V	62_F	1.485	1.00
4_V	7_V	1.470	1.00
32_R	35_R	1.430	1.00
78_P	81_T	1.425	1.00
44_A	90_L	1.424	1.00
86_A	122_L	1.393	1.00
43_L	46_F	1.391	1.00
99_D	102_R	1.378	1.00
36_L	39_M	1.378	1.00
7_V	10_L	1.351	1.00
93_L	116_V	1.347	1.00
111_R	115_L	1.346	1.00
111_R	114_R	1.325	1.00
66_D	70_P	1.322	1.00
67_L	70_P	1.314	1.00
66_D	72_A	1.305	1.00
21_P	24_P	1.297	1.00
108_R	112_L	1.295	1.00
77_R	80_I	1.237	1.00
42_L	46_F	1.186	1.00
60_Y	69_V	1.158	1.00
10_L	14_L	1.156	1.00
107_R	111_R	1.150	1.00
24_P	29_G	1.150	1.00
12_T	40_L	1.137	1.00
96_T	112_L	1.124	1.00
7_V	14_L	1.114	1.00
69_V	73_D	1.104	1.00
73_D	77_R	1.103	1.00
100_L	104_L	1.090	1.00
71_F	74_I	1.083	1.00
31_D	35_R	1.073	1.00
53_L	57_V	1.068	1.00
20_T	23_R	1.064	1.00
75_Y	78_P	1.062	1.00
58_D	61_A	1.061	1.00
68_L	72_A	1.059	1.00
7_V	11_L	1.058	1.00
70_P	73_D	1.053	1.00
10_L	120_A	1.051	1.00
48_A	52_V	1.040	1.00
8_L	12_T	1.040	1.00
95_V	101_A	1.035	1.00
42_L	94_A	1.015	1.00
9_L	44_A	1.013	1.00
26_R	29_G	1.012	1.00
70_P	74_I	1.004	1.00
71_F	75_Y	0.979	1.00
57_V	61_A	0.970	1.00
78_P	82_L	0.959	1.00
115_L	119_A	0.931	1.00
48_A	123_A	0.926	1.00
89_L	115_L	0.919	1.00
94_A	97_S	0.916	1.00
93_L	96_T	0.909	1.00
50_L	54_T	0.904	1.00
37_H	113_H	0.903	1.00
67_L	71_F	0.897	1.00
49_L	53_L	0.893	1.00
19_V	22_L	0.891	1.00
79_F	82_L	0.887	1.00
73_D	80_I	0.873	1.00
4_V	8_L	0.870	1.00
59_D	62_F	0.857	1.00
54_T	58_D	0.852	1.00
37_H	93_L	0.849	1.00
76_K	80_I	0.848	1.00
98_T	102_R	0.843	1.00
82_L	122_L	0.840	1.00
76_K	79_F	0.840	1.00
66_D	69_V	0.838	1.00
85_V	88_L	0.830	1.00
55_Y	58_D	0.804	1.00
23_R	26_R	0.803	1.00
49_L	52_V	0.802	1.00
75_Y	81_T	0.801	1.00
63_D	68_L	0.799	1.00
66_D	71_F	0.798	1.00
30_L	33_L	0.798	1.00
25_L	29_G	0.795	1.00
10_L	13_L	0.793	1.00
116_V	119_A	0.788	1.00
106_Y	110_R	0.788	1.00
89_L	92_A	0.786	1.00
24_P	30_L	0.776	1.00
63_D	69_V	0.775	1.00
8_L	47_Y	0.774	1.00
49_L	91_L	0.764	1.00
85_V	89_L	0.764	1.00
90_L	97_S	0.760	1.00
37_H	45_F	0.754	1.00
68_L	73_D	0.752	1.00
48_A	87_L	0.751	1.00
75_Y	80_I	0.737	1.00
24_P	28_L	0.737	1.00
28_L	32_R	0.736	1.00
90_L	94_A	0.720	1.00
6_L	10_L	0.709	1.00
81_T	84_F	0.704	1.00
66_D	73_D	0.700	1.00
18_R	22_L	0.699	1.00
27_G	31_D	0.698	1.00
57_V	60_Y	0.695	1.00
74_I	81_T	0.686	1.00
39_M	42_L	0.674	1.00
26_R	31_D	0.673	1.00
26_R	30_L	0.665	1.00
18_R	21_P	0.659	1.00
19_V	23_R	0.658	1.00
92_A	95_V	0.657	1.00
35_R	39_M	0.655	1.00
28_L	33_L	0.644	1.00
77_R	81_T	0.643	1.00
81_T	85_V	0.641	1.00
74_I	77_R	0.633	1.00
28_L	31_D	0.631	1.00
72_A	76_K	0.631	1.00
43_L	47_Y	0.629	1.00
60_Y	63_D	0.626	1.00
102_R	106_Y	0.625	1.00
62_F	66_D	0.621	1.00
63_D	66_D	0.612	1.00
74_I	78_P	0.609	1.00
118_L	122_L	0.609	1.00
24_P	27_G	0.608	1.00
55_Y	63_D	0.606	1.00
31_D	34_L	0.601	1.00
63_D	67_L	0.598	1.00
5_A	44_A	0.593	1.00
25_L	28_L	0.589	1.00
87_L	91_L	0.585	1.00
74_I	80_I	0.583	1.00
55_Y	70_P	0.575	1.00
112_L	116_V	0.570	1.00
27_G	32_R	0.565	1.00
48_A	86_A	0.562	1.00
76_K	81_T	0.556	1.00
70_P	76_K	0.554	1.00
37_H	97_S	0.549	1.00
114_R	117_Y	0.546	1.00
112_L	115_L	0.536	1.00
101_A	105_G	0.534	1.00
8_L	44_A	0.533	1.00
9_L	120_A	0.533	1.00
59_D	63_D	0.532	1.00
38_R	42_L	0.531	1.00
52_V	56_L	0.531	1.00
11_L	14_L	0.521	1.00
52_V	84_F	0.519	1.00
88_L	92_A	0.518	1.00
44_A	47_Y	0.518	1.00
12_T	15_L	0.518	1.00
69_V	76_K	0.517	1.00
26_R	32_R	0.514	1.00
44_A	48_A	0.513	1.00
100_L	103_R	0.509	1.00
90_L	119_A	0.507	1.00
82_L	86_A	0.503	1.00
62_F	67_L	0.503	1.00
9_L	12_T	0.503	1.00
70_P	77_R	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4o6yA	2	0.7823	79	0.781	Contact Map
1kqfC	3	0.9919	7.5	0.879	Contact Map
2bs2C	2	0.8548	6.6	0.883	Contact Map
4i0uA	4	0.4516	4.6	0.891	Contact Map
4ev6A	3	0.75	3.5	0.897	Contact Map
4hyjA	2	0.4274	3.2	0.899	Contact Map
3j2wE	1	0.371	3	0.901	Contact Map
4jq6A	3	0.379	2.8	0.902	Contact Map
2l6wA	2	0.2984	2.8	0.902	Contact Map
3wt9A	1	0.4435	2.2	0.908	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.