Pep_M12B_propep - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Pep_M12B_propep - Reprolysin family propeptide

PFAM:	PF01562	Sequences: EVVIPVRVDADGEFLSHELRRKRSLSSPSEDQLSYSLTAFGKDFVLHLEPNKDLLAPGFTVETYSEDGALVTDSPFVEDCYYQGYVEGDPGSLVALSTCDGLRGLIQTGNEEYFIEPLESSSEDSSGFEHVVY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	133 (123)
Sequences:	3186 (2095)
Seq/√Len:	188.9
META:	0.168

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
80_C	99_C	6.195	1.00
47_H	87_E	4.527	1.00
39_A	44_F	3.104	1.00
96_L	104_G	2.976	1.00
98_T	102_L	2.688	1.00
51_N	83_Q	2.665	1.00
38_T	43_D	2.282	1.00
51_N	54_L	2.135	1.00
47_H	85_Y	2.053	1.00
89_D	108_T	2.018	1.00
36_S	43_D	1.813	1.00
39_A	132_V	1.811	1.00
84_G	94_V	1.677	1.00
22_K	25_L	1.621	1.00
20_R	24_S	1.620	1.00
81_Y	97_S	1.613	1.00
107_Q	112_E	1.581	1.00
40_F	44_F	1.573	1.00
80_C	97_S	1.573	1.00
122_S	125_S	1.502	1.00
44_F	108_T	1.499	1.00
111_E	118_L	1.496	1.00
86_V	106_I	1.477	1.00
116_E	133_Y	1.465	1.00
21_R	24_S	1.458	1.00
23_R	27_S	1.421	1.00
71_V	74_S	1.412	1.00
20_R	23_R	1.384	1.00
48_L	94_V	1.382	1.00
88_G	92_S	1.376	1.00
6_V	10_A	1.371	1.00
80_C	101_G	1.359	1.00
24_S	27_S	1.334	1.00
80_C	130_H	1.332	1.00
40_F	81_Y	1.325	1.00
80_C	98_T	1.323	1.00
31_D	52_K	1.269	1.00
34_S	47_H	1.251	1.00
86_V	108_T	1.249	1.00
6_V	9_D	1.246	1.00
35_Y	102_L	1.225	1.00
125_S	129_E	1.198	1.00
95_A	105_L	1.174	1.00
113_Y	116_E	1.161	1.00
70_L	73_D	1.160	1.00
8_V	21_R	1.135	1.00
54_L	80_C	1.112	1.00
7_R	10_A	1.110	1.00
35_Y	106_I	1.100	1.00
20_R	25_L	1.082	1.00
94_V	106_I	1.080	1.00
34_S	87_E	1.074	1.00
56_A	60_T	1.064	1.00
59_F	63_T	1.060	1.00
42_K	88_G	1.052	1.00
97_S	130_H	1.050	1.00
99_C	130_H	1.048	1.00
87_E	98_T	1.042	1.00
26_S	29_S	1.028	1.00
48_L	84_G	1.004	1.00
98_T	101_G	1.004	1.00
44_F	113_Y	0.996	0.99
21_R	25_L	0.995	0.99
44_F	86_V	0.967	0.99
23_R	26_S	0.963	0.99
50_P	82_Y	0.962	0.99
111_E	115_I	0.953	0.99
89_D	92_S	0.952	0.99
67_D	70_L	0.950	0.99
83_Q	98_T	0.950	0.99
80_C	117_P	0.933	0.99
61_V	72_T	0.918	0.99
24_S	29_S	0.899	0.99
21_R	29_S	0.896	0.99
118_L	131_V	0.895	0.99
22_K	27_S	0.893	0.99
70_L	75_P	0.869	0.99
49_E	83_Q	0.866	0.99
80_C	104_G	0.858	0.98
93_L	114_F	0.856	0.98
121_S	126_S	0.853	0.98
4_I	10_A	0.845	0.98
102_L	117_P	0.838	0.98
103_R	110_N	0.837	0.98
101_G	117_P	0.835	0.98
96_L	99_C	0.834	0.98
53_D	57_P	0.821	0.98
22_K	26_S	0.816	0.98
89_D	109_G	0.813	0.98
34_S	45_V	0.806	0.98
82_Y	97_S	0.805	0.98
45_V	87_E	0.804	0.98
70_L	74_S	0.803	0.98
82_Y	92_S	0.797	0.97
59_F	62_E	0.789	0.97
24_S	28_P	0.789	0.97
26_S	30_E	0.785	0.97
83_Q	132_V	0.774	0.97
7_R	35_Y	0.766	0.97
126_S	129_E	0.765	0.97
55_L	81_Y	0.765	0.97
120_S	124_D	0.765	0.97
95_A	99_C	0.764	0.97
75_P	79_D	0.754	0.96
10_A	24_S	0.754	0.96
83_Q	95_A	0.753	0.96
52_K	56_A	0.747	0.96
33_L	98_T	0.743	0.96
122_S	127_G	0.741	0.96
23_R	29_S	0.741	0.96
22_K	29_S	0.741	0.96
54_L	99_C	0.741	0.96
83_Q	93_L	0.739	0.96
35_Y	48_L	0.735	0.96
68_G	71_V	0.733	0.96
124_D	127_G	0.728	0.96
103_R	116_E	0.728	0.96
71_V	76_F	0.707	0.95
36_S	45_V	0.706	0.95
111_E	114_F	0.703	0.95
127_G	131_V	0.702	0.95
21_R	27_S	0.702	0.95
95_A	130_H	0.698	0.95
66_E	70_L	0.696	0.94
23_R	30_E	0.688	0.94
37_L	44_F	0.685	0.94
99_C	102_L	0.677	0.94
6_V	43_D	0.676	0.94
80_C	95_A	0.673	0.93
51_N	81_Y	0.671	0.93
107_Q	111_E	0.668	0.93
74_S	77_V	0.662	0.93
50_P	59_F	0.656	0.93
124_D	128_F	0.655	0.93
46_L	106_I	0.653	0.92
25_L	28_P	0.648	0.92
99_C	117_P	0.647	0.92
89_D	106_I	0.641	0.92
27_S	30_E	0.636	0.91
4_I	7_R	0.636	0.91
4_I	9_D	0.633	0.91
115_I	132_V	0.627	0.91
66_E	69_A	0.627	0.91
22_K	28_P	0.626	0.91
97_S	101_G	0.626	0.91
34_S	109_G	0.624	0.91
21_R	26_S	0.615	0.90
99_C	104_G	0.612	0.90
59_F	92_S	0.608	0.89
8_V	19_L	0.601	0.89
75_P	78_E	0.596	0.89
23_R	48_L	0.596	0.89
60_T	74_S	0.594	0.88
93_L	107_Q	0.579	0.87
120_S	125_S	0.573	0.87
63_T	82_Y	0.571	0.86
68_G	72_T	0.570	0.86
48_L	56_A	0.568	0.86
91_G	108_T	0.565	0.86
35_Y	99_C	0.562	0.85
20_R	26_S	0.562	0.85
86_V	89_D	0.555	0.85
82_Y	101_G	0.551	0.84
40_F	53_D	0.550	0.84
43_D	76_F	0.549	0.84
122_S	128_F	0.545	0.84
32_Q	42_K	0.540	0.83
55_L	71_V	0.536	0.83
44_F	65_S	0.534	0.83
55_L	59_F	0.533	0.82
40_F	46_L	0.531	0.82
76_F	79_D	0.528	0.82
65_S	69_A	0.527	0.82
8_V	34_S	0.526	0.82
119_E	129_E	0.524	0.81
59_F	75_P	0.523	0.81
121_S	129_E	0.522	0.81
82_Y	106_I	0.519	0.81
54_L	95_A	0.515	0.80
85_Y	92_S	0.514	0.80
128_F	131_V	0.508	0.79
39_A	42_K	0.505	0.79
128_F	132_V	0.505	0.79
54_L	81_Y	0.500	0.78

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4on1A	1	0.7218	50.9	0.882	Contact Map
2kd0A	1	0.6391	6.7	0.923	Contact Map
4pyuA	1	0.5564	6.7	0.923	Contact Map
4hcnB	1	0.5564	6.6	0.923	Contact Map
3m63B	1	0.5414	5.9	0.925	Contact Map
3phxB	1	0.5714	5.4	0.926	Contact Map
3dbhI	1	0.6241	5.4	0.926	Contact Map
1wggA	1	0.7143	5.3	0.927	Contact Map
3pluA	1	0.5414	4.8	0.928	Contact Map
4dguA	4	0.4436	4.6	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.