zf-DHHC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

zf-DHHC - DHHC palmitoyltransferase

PFAM:	PF01529	Sequences: QNVRLRYCKTCNIYKPPRSHHCSVCNRCVLKFDHHCPWVNNCVGKRNYRYFLLFLLYLTLLCLYVLILSLYYLIRLISDSSLSSLLLLSLLGSPLLILLLVLSLLFLLFLGGLLGFHLYLILRNQTTIEYLKKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	134 (128)
Sequences:	8194 (6224)
Seq/√Len:	550.1
META:	0.372

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_C	35_H	3.848	1.00
21_H	28_C	3.657	1.00
30_L	45_K	3.481	1.00
52_L	118_L	3.333	1.00
25_C	42_C	3.121	1.00
35_H	42_C	2.745	1.00
11_C	21_H	2.718	1.00
31_K	48_Y	2.577	1.00
22_C	25_C	2.354	1.00
48_Y	117_H	2.331	1.00
29_V	44_G	2.306	1.00
18_R	129_E	2.223	1.00
16_P	19_S	2.117	1.00
11_C	28_C	2.067	1.00
20_H	128_I	2.063	1.00
116_F	120_L	1.990	1.00
39_V	43_V	1.870	1.00
22_C	42_C	1.857	1.00
31_K	45_K	1.833	1.00
70_L	74_I	1.822	1.00
32_F	128_I	1.811	1.00
56_L	114_L	1.794	1.00
116_F	130_Y	1.623	1.00
119_Y	123_R	1.605	1.00
53_L	57_Y	1.603	1.00
49_R	53_L	1.555	1.00
59_T	114_L	1.555	1.00
115_G	119_Y	1.553	1.00
67_I	71_Y	1.494	1.00
36_C	51_F	1.491	1.00
117_H	127_T	1.485	1.00
59_T	111_G	1.427	1.00
128_I	132_K	1.408	1.00
20_H	32_F	1.407	1.00
44_G	47_N	1.339	1.00
63_L	107_L	1.331	1.00
117_H	120_L	1.279	1.00
55_L	114_L	1.266	1.00
109_F	113_L	1.230	1.00
64_Y	68_L	1.230	1.00
33_D	36_C	1.223	1.00
7_Y	12_N	1.206	1.00
33_D	51_F	1.182	1.00
8_C	11_C	1.181	1.00
22_C	35_H	1.172	1.00
52_L	114_L	1.163	1.00
15_K	20_H	1.151	1.00
56_L	118_L	1.143	1.00
18_R	31_K	1.140	1.00
66_L	104_L	1.103	1.00
113_L	117_H	1.101	1.00
7_Y	14_Y	1.087	1.00
66_L	107_L	1.062	1.00
118_L	122_L	1.060	1.00
85_L	89_S	1.049	1.00
10_T	128_I	1.046	1.00
125_Q	130_Y	1.035	1.00
119_Y	122_L	1.033	1.00
15_K	128_I	1.033	1.00
110_L	113_L	1.000	1.00
61_L	65_V	0.997	1.00
74_I	78_S	0.991	1.00
52_L	121_I	0.954	1.00
21_H	25_C	0.935	1.00
63_L	111_G	0.907	1.00
62_C	106_F	0.906	1.00
59_T	107_L	0.902	1.00
20_H	23_S	0.882	1.00
70_L	100_L	0.879	1.00
114_L	118_L	0.877	1.00
18_R	124_N	0.872	1.00
62_C	107_L	0.868	1.00
54_F	58_L	0.855	1.00
34_H	51_F	0.854	1.00
6_R	15_K	0.850	1.00
16_P	30_L	0.849	1.00
5_L	17_P	0.846	1.00
21_H	26_N	0.846	1.00
82_L	86_L	0.836	1.00
39_V	54_F	0.835	1.00
106_F	109_F	0.834	1.00
105_L	109_F	0.830	1.00
116_F	119_Y	0.829	1.00
85_L	88_L	0.826	1.00
55_L	110_L	0.822	1.00
49_R	57_Y	0.821	1.00
120_L	130_Y	0.811	1.00
50_Y	53_L	0.811	1.00
52_L	56_L	0.808	1.00
106_F	110_L	0.805	1.00
89_S	92_G	0.796	1.00
84_S	89_S	0.795	1.00
82_L	85_L	0.784	1.00
58_L	62_C	0.783	1.00
32_F	42_C	0.776	1.00
116_F	127_T	0.775	1.00
81_S	84_S	0.772	1.00
120_L	127_T	0.769	1.00
31_K	124_N	0.757	1.00
30_L	46_R	0.753	1.00
75_R	79_D	0.748	1.00
62_C	103_S	0.745	1.00
76_L	79_D	0.735	1.00
74_I	77_I	0.733	1.00
85_L	90_L	0.733	1.00
88_L	91_L	0.733	1.00
8_C	21_H	0.722	1.00
81_S	90_L	0.719	1.00
126_T	129_E	0.716	1.00
8_C	28_C	0.715	1.00
65_V	103_S	0.711	1.00
111_G	115_G	0.711	1.00
84_S	88_L	0.700	1.00
25_C	28_C	0.699	1.00
7_Y	13_I	0.695	1.00
28_C	35_H	0.695	1.00
50_Y	57_Y	0.691	1.00
10_T	13_I	0.688	1.00
80_S	84_S	0.687	1.00
37_P	41_N	0.686	1.00
84_S	87_L	0.685	1.00
10_T	15_K	0.683	1.00
65_V	68_L	0.681	1.00
11_C	25_C	0.681	1.00
83_S	87_L	0.679	1.00
84_S	90_L	0.678	1.00
58_L	110_L	0.675	1.00
55_L	59_T	0.668	1.00
18_R	126_T	0.667	1.00
51_F	113_L	0.664	1.00
59_T	110_L	0.654	1.00
77_I	80_S	0.654	1.00
10_T	20_H	0.653	1.00
119_Y	130_Y	0.649	1.00
19_S	30_L	0.646	1.00
82_L	87_L	0.644	1.00
14_Y	17_P	0.639	1.00
15_K	23_S	0.632	1.00
8_C	42_C	0.631	1.00
117_H	121_I	0.626	1.00
10_T	23_S	0.625	1.00
61_L	64_Y	0.619	1.00
78_S	82_L	0.618	1.00
78_S	84_S	0.614	1.00
32_F	41_N	0.612	1.00
30_L	57_Y	0.611	1.00
72_Y	75_R	0.610	1.00
6_R	14_Y	0.607	1.00
81_S	86_L	0.600	1.00
81_S	85_L	0.597	1.00
64_Y	67_I	0.597	1.00
88_L	92_G	0.584	1.00
15_K	37_P	0.584	1.00
87_L	90_L	0.583	1.00
79_D	87_L	0.581	0.99
15_K	32_F	0.578	0.99
100_L	104_L	0.575	0.99
71_Y	75_R	0.574	0.99
107_L	111_G	0.570	0.99
60_L	64_Y	0.569	0.99
87_L	91_L	0.569	0.99
83_S	86_L	0.566	0.99
72_Y	76_L	0.564	0.99
86_L	90_L	0.556	0.99
36_C	113_L	0.555	0.99
45_K	48_Y	0.552	0.99
75_R	84_S	0.551	0.99
96_L	100_L	0.550	0.99
128_I	131_L	0.547	0.99
63_L	67_I	0.543	0.99
99_L	102_L	0.541	0.99
99_L	103_S	0.539	0.99
94_P	98_L	0.533	0.99
81_S	87_L	0.532	0.99
89_S	93_S	0.531	0.99
115_G	118_L	0.529	0.99
106_F	116_F	0.529	0.99
83_S	88_L	0.528	0.99
108_L	112_G	0.524	0.99
21_H	35_H	0.522	0.99
69_S	100_L	0.519	0.99
31_K	126_T	0.517	0.99
80_S	83_S	0.514	0.99
101_V	105_L	0.514	0.99
97_I	101_V	0.513	0.99
56_L	60_L	0.510	0.99
87_L	92_G	0.510	0.99
90_L	93_S	0.508	0.99
62_C	66_L	0.504	0.99
83_S	89_S	0.503	0.99
78_S	92_G	0.501	0.99
85_L	92_G	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vrwB	1	0.2612	21.1	0.901	Contact Map
2dktA	1	0.4328	20.5	0.902	Contact Map
1wflA	1	0.3657	20.1	0.902	Contact Map
3j21i	1	0.3657	15.2	0.907	Contact Map
3j21g	1	0.2836	14.2	0.909	Contact Map
3ky9A	1	0.2687	13	0.91	Contact Map
1wg2A	1	0.3657	11.6	0.912	Contact Map
1wfhA	1	0.3657	10.1	0.915	Contact Map
3mpxA	1	0	9.9	0.915	Contact Map
1wfpA	1	0.3657	9.3	0.916	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.