Grp1_Fun34_YaaH - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Grp1_Fun34_YaaH - GPR1/FUN34/yaaH family

PFAM:	PF01184	Sequences: FGGTLQPGAAPVPKDKIANPAPLGLAGFALTTFLLSLHNAGLFGLGSPGVVLGMALFYGGLAQLIAGMWEFKKGNTFGATAFTSYGAFWLSLALLLLPKFGIAAAYGAPPADAGTALGLYLLAWGIFTLYMFIATLRTNRALQLVFLLLTITFFLLAIGDFTGSAGLTKIGGYEGIITALLAWYAAAAGVLNETFGRTVLPVGPLPW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	207 (178)
Sequences:	8000 (4561)
Seq/√Len:	341.9
META:	0.788

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
141_A	185_A	3.209	1.00
129_L	150_T	3.028	1.00
144_L	181_L	2.993	1.00
159_G	168_T	2.947	1.00
132_F	147_L	2.728	1.00
130_Y	187_A	2.696	1.00
67_G	83_T	2.605	1.00
160_D	168_T	2.592	1.00
155_L	174_E	2.499	1.00
127_F	131_M	2.411	1.00
125_G	154_F	2.272	1.00
166_G	170_I	2.243	1.00
125_G	157_A	2.098	1.00
118_G	161_F	2.092	1.00
57_F	90_L	2.089	1.00
122_L	157_A	2.058	1.00
26_A	186_A	2.035	1.00
85_Y	128_T	2.026	1.00
130_Y	186_A	2.022	1.00
91_S	120_Y	2.010	1.00
37_L	42_L	2.000	1.00
132_F	143_Q	1.983	1.00
148_L	181_L	1.954	1.00
40_A	173_Y	1.846	1.00
62_A	87_A	1.844	1.00
58_Y	84_S	1.833	1.00
69_W	79_A	1.819	1.00
65_I	68_M	1.785	1.00
34_L	54_M	1.764	1.00
148_L	177_I	1.737	1.00
136_L	143_Q	1.728	1.00
36_S	175_G	1.719	1.00
68_M	83_T	1.707	1.00
70_E	75_N	1.617	1.00
151_I	174_E	1.594	1.00
122_L	161_F	1.593	1.00
144_L	177_I	1.577	1.00
132_F	150_T	1.537	1.00
37_L	119_L	1.525	1.00
70_E	78_G	1.524	1.00
30_L	123_A	1.520	1.00
155_L	167_L	1.498	1.00
140_R	143_Q	1.446	1.00
155_L	170_I	1.441	1.00
129_L	154_F	1.431	1.00
154_F	158_I	1.403	1.00
134_A	191_L	1.401	1.00
150_T	154_F	1.376	1.00
151_I	155_L	1.339	1.00
93_A	97_L	1.330	1.00
165_A	169_K	1.327	1.00
158_I	167_L	1.312	1.00
71_F	79_A	1.310	1.00
33_F	183_W	1.307	1.00
24_G	66_A	1.272	1.00
99_K	102_I	1.264	1.00
64_L	87_A	1.251	1.00
145_V	181_L	1.249	1.00
30_L	183_W	1.246	1.00
152_T	175_G	1.245	1.00
129_L	133_I	1.231	1.00
114_G	160_D	1.227	1.00
57_F	94_L	1.209	1.00
132_F	136_L	1.203	1.00
17_I	71_F	1.186	1.00
148_L	178_T	1.173	1.00
157_A	161_F	1.172	1.00
101_G	104_A	1.171	1.00
81_A	146_F	1.169	1.00
144_L	148_L	1.153	1.00
118_G	122_L	1.144	1.00
132_F	135_T	1.143	1.00
19_N	73_K	1.135	1.00
185_A	189_G	1.130	1.00
187_A	191_L	1.128	1.00
103_A	106_Y	1.122	1.00
84_S	124_W	1.110	1.00
164_S	167_L	1.107	1.00
84_S	127_F	1.075	1.00
18_A	76_T	1.064	1.00
99_K	103_A	1.042	1.00
102_I	106_Y	1.042	1.00
145_V	185_A	1.033	1.00
131_M	190_V	1.030	1.00
156_L	171_G	1.023	1.00
33_F	123_A	1.022	1.00
143_Q	147_L	1.012	1.00
81_A	131_M	1.009	1.00
129_L	132_F	0.998	1.00
169_K	173_Y	0.998	1.00
125_G	150_T	0.995	1.00
17_I	73_K	0.987	1.00
64_L	83_T	0.982	1.00
33_F	179_A	0.979	1.00
158_I	162_T	0.972	1.00
54_M	91_S	0.963	1.00
40_A	176_I	0.959	1.00
135_T	143_Q	0.957	1.00
64_L	90_L	0.948	1.00
36_S	152_T	0.945	1.00
92_L	117_L	0.940	1.00
22_P	189_G	0.934	1.00
170_I	174_E	0.930	1.00
79_A	83_T	0.927	1.00
75_N	78_G	0.922	1.00
95_L	117_L	0.911	1.00
128_T	149_L	0.900	1.00
142_L	185_A	0.900	1.00
138_T	142_L	0.898	1.00
147_L	150_T	0.897	1.00
23_L	83_T	0.894	1.00
149_L	178_T	0.889	1.00
128_T	150_T	0.888	1.00
135_T	138_T	0.879	1.00
139_N	142_L	0.861	1.00
173_Y	177_I	0.859	1.00
36_S	39_N	0.856	1.00
101_G	106_Y	0.848	1.00
99_K	104_A	0.833	1.00
159_G	171_G	0.832	1.00
98_P	102_I	0.823	1.00
50_V	116_A	0.818	1.00
83_T	87_A	0.817	1.00
177_I	181_L	0.817	1.00
117_L	160_D	0.816	1.00
166_G	169_K	0.815	1.00
52_L	96_L	0.814	1.00
147_L	151_I	0.814	1.00
148_L	174_E	0.814	1.00
16_K	74_G	0.812	1.00
39_N	156_L	0.810	1.00
40_A	172_G	0.807	1.00
29_A	179_A	0.800	1.00
65_I	69_W	0.796	1.00
17_I	69_W	0.796	1.00
26_A	187_A	0.796	1.00
29_A	182_A	0.795	1.00
29_A	33_F	0.784	1.00
119_L	161_F	0.784	1.00
61_L	90_L	0.780	1.00
170_I	173_Y	0.774	1.00
126_I	180_L	0.774	1.00
27_G	62_A	0.772	1.00
37_L	43_F	0.767	1.00
135_T	146_F	0.764	1.00
26_A	183_W	0.762	1.00
32_T	63_Q	0.761	1.00
121_L	159_G	0.757	1.00
60_G	90_L	0.752	1.00
141_A	188_A	0.748	1.00
17_I	72_K	0.744	1.00
174_E	177_I	0.743	1.00
29_A	183_W	0.741	0.99
54_M	120_Y	0.739	0.99
62_A	83_T	0.737	0.99
31_T	59_G	0.736	0.99
165_A	168_T	0.732	0.99
35_L	121_L	0.729	0.99
15_D	73_K	0.729	0.99
19_N	189_G	0.728	0.99
15_D	72_K	0.726	0.99
122_L	154_F	0.723	0.99
38_H	48_P	0.723	0.99
98_P	101_G	0.718	0.99
125_G	129_L	0.714	0.99
16_K	73_K	0.714	0.99
38_H	47_S	0.713	0.99
43_F	47_S	0.709	0.99
21_A	70_E	0.709	0.99
61_L	65_I	0.708	0.99
152_T	174_E	0.704	0.99
92_L	96_L	0.699	0.99
98_P	104_A	0.698	0.99
159_G	167_L	0.696	0.99
67_G	86_G	0.694	0.99
52_L	93_A	0.692	0.99
41_G	169_K	0.687	0.99
38_H	43_F	0.684	0.99
37_L	176_I	0.684	0.99
152_T	178_T	0.683	0.99
188_A	192_N	0.682	0.99
64_L	86_G	0.680	0.99
138_T	194_T	0.680	0.99
119_L	122_L	0.680	0.99
176_I	180_L	0.678	0.99
80_T	131_M	0.678	0.99
101_G	105_A	0.667	0.99
120_Y	124_W	0.667	0.99
162_T	165_A	0.663	0.99
53_G	94_L	0.663	0.99
85_Y	153_F	0.661	0.99
179_A	183_W	0.652	0.99
21_A	82_F	0.645	0.99
116_A	119_L	0.643	0.99
60_G	86_G	0.643	0.99
76_T	193_E	0.640	0.99
100_F	104_A	0.640	0.99
141_A	181_L	0.639	0.99
33_F	180_L	0.639	0.99
122_L	126_I	0.638	0.98
94_L	98_P	0.634	0.98
28_F	85_Y	0.630	0.98
110_P	113_A	0.630	0.98
22_P	76_T	0.630	0.98
114_G	163_G	0.629	0.98
142_L	145_V	0.628	0.98
56_L	93_A	0.625	0.98
18_A	79_A	0.620	0.98
99_K	106_Y	0.619	0.98
100_F	103_A	0.618	0.98
114_G	117_L	0.614	0.98
34_L	123_A	0.606	0.98
36_S	55_A	0.604	0.98
42_L	173_Y	0.602	0.98
134_A	187_A	0.597	0.98
113_A	117_L	0.596	0.98
100_F	106_Y	0.595	0.98
180_L	183_W	0.594	0.98
43_F	46_G	0.593	0.98
178_T	181_L	0.583	0.97
141_A	145_V	0.579	0.97
99_K	105_A	0.577	0.97
167_L	170_I	0.577	0.97
57_F	61_L	0.576	0.97
86_G	90_L	0.571	0.97
98_P	106_Y	0.566	0.97
98_P	103_A	0.566	0.97
55_A	93_A	0.565	0.97
112_D	115_T	0.563	0.97
97_L	102_I	0.561	0.97
93_A	98_P	0.559	0.97
53_G	95_L	0.557	0.96
184_Y	188_A	0.556	0.96
174_E	178_T	0.555	0.96
30_L	127_F	0.554	0.96
34_L	51_V	0.554	0.96
139_N	143_Q	0.553	0.96
57_F	93_A	0.547	0.96
17_I	74_G	0.546	0.96
56_L	97_L	0.545	0.96
91_S	95_L	0.544	0.96
43_F	116_A	0.542	0.96
88_F	153_F	0.541	0.96
121_L	171_G	0.541	0.96
160_D	163_G	0.540	0.96
23_L	71_F	0.538	0.96
134_A	194_T	0.534	0.96
37_L	40_A	0.530	0.95
118_G	157_A	0.529	0.95
84_S	87_A	0.529	0.95
139_N	185_A	0.529	0.95
44_G	115_T	0.526	0.95
140_R	144_L	0.525	0.95
81_A	145_V	0.523	0.95
150_T	157_A	0.521	0.95
111_A	115_T	0.520	0.95
42_L	176_I	0.520	0.95
45_L	48_P	0.519	0.95
138_T	189_G	0.517	0.95
40_A	169_K	0.517	0.95
55_A	59_G	0.511	0.94
123_A	179_A	0.510	0.94
25_L	81_A	0.509	0.94
115_T	118_G	0.503	0.94
155_L	171_G	0.501	0.94
128_T	153_F	0.500	0.94
19_N	76_T	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ux4A	3	0.7729	51.7	0.917	Contact Map
4ogqG	1	0.1787	4.4	0.951	Contact Map
1q90G	1	0.1449	2.8	0.955	Contact Map
4cbkA	3	0.1739	1.6	0.961	Contact Map
1wu0A	1	0.1787	1.3	0.963	Contact Map
4f4sA	3	0.1787	1.3	0.963	Contact Map
4wfeA	2	0.2271	1	0.966	Contact Map
4lxjA	1	0.2754	1	0.966	Contact Map
4bu0A	1	0.285	1	0.966	Contact Map
3wu2Y	1	0.1353	0.9	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.