Cys_rich_FGFR - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Cys_rich_FGFR - Cysteine rich repeat

PFAM:	PF00839	Sequences: PECRAELFRLQEQLAEDYRLDPELAKACKDDIEKFCSDVPPGEGRVLECLKENKDDLQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	58 (55)
Sequences:	3004 (2348)
Seq/√Len:	316.7
META:	0.522

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_I	46_V	5.803	1.00
53_N	56_D	3.293	1.00
21_D	24_L	2.337	1.00
18_Y	32_I	2.259	1.00
42_G	45_R	1.921	1.00
35_F	53_N	1.859	1.00
31_D	34_K	1.752	1.00
8_F	11_Q	1.729	1.00
6_E	10_L	1.720	1.00
6_E	9_R	1.696	1.00
18_Y	46_V	1.693	1.00
39_V	45_R	1.591	1.00
11_Q	14_L	1.532	1.00
47_L	51_K	1.514	1.00
4_R	9_R	1.423	1.00
7_L	14_L	1.216	1.00
31_D	35_F	1.139	1.00
25_A	29_K	1.106	1.00
41_P	45_R	1.100	1.00
51_K	54_K	1.051	1.00
42_G	46_V	1.034	1.00
48_E	52_E	1.029	1.00
10_L	13_Q	1.000	1.00
29_K	33_E	0.997	1.00
6_E	24_L	0.978	1.00
48_E	51_K	0.962	1.00
26_K	33_E	0.960	1.00
11_Q	15_A	0.959	1.00
17_D	24_L	0.953	1.00
32_I	47_L	0.945	1.00
5_A	9_R	0.941	1.00
23_E	27_A	0.897	1.00
5_A	29_K	0.885	1.00
39_V	42_G	0.844	1.00
11_Q	51_K	0.820	1.00
9_R	12_E	0.814	1.00
10_L	14_L	0.801	1.00
4_R	8_F	0.799	1.00
47_L	54_K	0.789	1.00
12_E	15_A	0.788	1.00
30_D	34_K	0.786	1.00
10_L	23_E	0.783	1.00
16_E	22_P	0.782	1.00
16_E	20_L	0.781	1.00
18_Y	22_P	0.760	0.99
35_F	52_E	0.749	0.99
38_D	42_G	0.741	0.99
2_E	34_K	0.696	0.99
7_L	10_L	0.695	0.99
46_V	50_L	0.686	0.99
25_A	37_S	0.681	0.99
23_E	52_E	0.676	0.99
3_C	50_L	0.673	0.99
35_F	45_R	0.660	0.98
7_L	31_D	0.658	0.98
20_L	23_E	0.650	0.98
13_Q	51_K	0.644	0.98
44_G	48_E	0.642	0.98
8_F	12_E	0.619	0.98
35_F	38_D	0.615	0.98
24_L	47_L	0.609	0.97
22_P	26_K	0.602	0.97
13_Q	20_L	0.598	0.97
14_L	20_L	0.591	0.97
18_Y	24_L	0.587	0.97
4_R	7_L	0.582	0.97
17_D	21_D	0.577	0.96
3_C	28_C	0.568	0.96
12_E	16_E	0.554	0.95
2_E	5_A	0.549	0.95
40_P	52_E	0.549	0.95
28_C	36_C	0.540	0.95
19_R	26_K	0.536	0.95
2_E	15_A	0.530	0.94
15_A	24_L	0.529	0.94
28_C	49_C	0.526	0.94
7_L	44_G	0.524	0.94
29_K	56_D	0.517	0.94
13_Q	43_E	0.513	0.93
27_A	30_D	0.510	0.93
21_D	26_K	0.502	0.93
43_E	55_D	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4oj7A	3	0.6897	6.4	0.805	Contact Map
2fp1A	2	0.7241	5.3	0.812	Contact Map
3bq3A	2	0.569	3.8	0.825	Contact Map
2q13A	2	0.9483	3.3	0.829	Contact Map
2vrwB	1	0.6034	2.7	0.837	Contact Map
2r17C	1	0.7586	2.4	0.842	Contact Map
1chcA	1	0.431	2	0.847	Contact Map
2db6A	1	0.7241	2	0.849	Contact Map
2i5oA	1	0.4655	1.7	0.855	Contact Map
2ennA	1	0.6897	1.7	0.855	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.