FliP - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FliP - FliP family

PFAM:	PF00813	Sequences: LLTVLSLAPAILIMMTSFTRIVIVLSFLRQALGTQQTPPNQVLIGLALFLTFFVMAPVFDQIYEEALQPYLAGEITQEEALERASEPLREFMLKQTREKDLALFVDLAKEPATPEDVPLRVLIPAFVISELKTAFQIGFLIFLPFLVIDLVVASVLMSMGMMMLPPVMISLPFKLLLFVLVDGWNLLVGSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	191 (191)
Sequences:	14544 (7034)
Seq/√Len:	509.0
META:	0.852

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_Q	65_E	4.317	1.00
62_I	88_L	3.786	1.00
85_S	119_L	3.626	1.00
63_Y	68_Q	3.428	1.00
76_T	79_E	3.108	1.00
62_I	66_A	2.666	1.00
65_E	83_R	2.660	1.00
61_Q	90_E	2.574	1.00
68_Q	72_A	2.557	1.00
21_I	54_V	2.454	1.00
102_A	106_D	2.257	1.00
93_L	114_P	2.177	1.00
60_D	64_E	2.171	1.00
89_R	119_L	2.169	1.00
67_L	71_L	2.147	1.00
14_M	127_V	2.056	1.00
75_I	83_R	2.055	1.00
39_P	42_V	1.996	1.00
31_A	142_F	1.978	1.00
113_T	116_D	1.963	1.00
83_R	86_E	1.952	1.00
82_E	85_S	1.934	1.00
93_L	122_L	1.917	1.00
56_A	59_F	1.917	1.00
110_E	118_P	1.908	1.00
66_A	84_A	1.838	1.00
105_V	111_P	1.784	1.00
117_V	122_L	1.765	1.00
64_E	68_Q	1.759	1.00
79_E	83_R	1.736	1.00
21_I	50_L	1.735	1.00
97_R	100_D	1.725	1.00
90_E	94_K	1.720	1.00
104_F	128_I	1.711	1.00
79_E	82_E	1.686	1.00
68_Q	71_L	1.585	1.00
63_Y	67_L	1.559	1.00
29_R	40_N	1.542	1.00
89_R	93_L	1.536	1.00
21_I	25_L	1.532	1.00
97_R	133_T	1.530	1.00
22_V	43_L	1.484	1.00
91_F	126_F	1.468	1.00
23_I	131_L	1.448	1.00
56_A	120_R	1.444	1.00
61_Q	64_E	1.427	1.00
132_K	136_Q	1.425	1.00
15_M	123_I	1.423	1.00
58_V	61_Q	1.417	1.00
96_T	101_L	1.402	1.00
112_A	116_D	1.363	1.00
77_Q	81_L	1.355	1.00
129_S	133_T	1.352	1.00
44_I	47_A	1.349	1.00
24_V	191_L	1.348	1.00
63_Y	66_A	1.318	1.00
4_V	11_I	1.314	1.00
147_V	151_V	1.297	1.00
27_F	175_L	1.291	1.00
119_L	123_I	1.268	1.00
111_P	116_D	1.267	1.00
49_F	123_I	1.255	1.00
81_L	85_S	1.246	1.00
17_S	54_V	1.244	1.00
65_E	86_E	1.228	1.00
14_M	45_G	1.223	1.00
22_V	39_P	1.214	1.00
52_F	56_A	1.213	1.00
4_V	8_A	1.199	1.00
19_T	22_V	1.190	1.00
56_A	60_D	1.179	1.00
60_D	120_R	1.171	1.00
98_E	102_A	1.171	1.00
110_E	120_R	1.167	1.00
85_S	89_R	1.162	1.00
105_V	108_A	1.120	1.00
128_I	188_V	1.109	1.00
75_I	79_E	1.106	1.00
10_A	14_M	1.106	1.00
110_E	121_V	1.102	1.00
99_K	185_N	1.095	1.00
7_L	10_A	1.092	1.00
22_V	44_I	1.088	1.00
105_V	110_E	1.081	1.00
105_V	121_V	1.078	1.00
15_M	88_L	1.078	1.00
34_T	37_T	1.074	1.00
93_L	119_L	1.065	1.00
86_E	90_E	1.064	1.00
136_Q	140_L	1.063	1.00
78_E	82_E	1.039	1.00
182_D	185_N	1.030	1.00
81_L	119_L	1.023	1.00
26_S	30_Q	1.019	1.00
108_A	121_V	1.013	1.00
103_L	185_N	1.000	1.00
93_L	101_L	0.997	1.00
13_I	41_Q	0.997	1.00
19_T	23_I	0.994	1.00
30_Q	36_Q	0.984	1.00
84_A	87_P	0.981	1.00
49_F	124_P	0.980	1.00
121_V	125_A	0.977	1.00
185_N	189_G	0.974	1.00
111_P	117_V	0.970	1.00
93_L	117_V	0.963	1.00
157_M	163_M	0.953	1.00
25_L	28_L	0.944	1.00
89_R	122_L	0.944	1.00
8_A	14_M	0.939	1.00
70_Y	80_A	0.927	1.00
17_S	21_I	0.925	1.00
86_E	89_R	0.924	1.00
24_V	137_I	0.918	1.00
89_R	115_E	0.917	1.00
62_I	84_A	0.905	1.00
100_D	132_K	0.903	1.00
22_V	47_A	0.896	1.00
118_P	121_V	0.895	1.00
4_V	7_L	0.892	1.00
48_L	52_F	0.876	1.00
28_L	141_I	0.875	1.00
25_L	47_A	0.871	1.00
82_E	86_E	0.864	1.00
81_L	84_A	0.863	1.00
15_M	92_M	0.861	1.00
43_L	47_A	0.860	1.00
83_R	87_P	0.858	1.00
59_F	88_L	0.843	1.00
30_Q	33_G	0.840	1.00
86_E	115_E	0.839	1.00
7_L	11_I	0.834	1.00
45_G	127_V	0.830	1.00
27_F	34_T	0.830	1.00
63_Y	72_A	0.827	1.00
132_K	182_D	0.824	1.00
15_M	19_T	0.815	1.00
111_P	114_P	0.813	1.00
70_Y	77_Q	0.808	1.00
59_F	63_Y	0.797	1.00
154_S	157_M	0.790	1.00
128_I	185_N	0.790	1.00
61_Q	87_P	0.788	1.00
96_T	122_L	0.787	1.00
176_L	188_V	0.777	1.00
6_S	10_A	0.772	1.00
96_T	133_T	0.770	1.00
66_A	75_I	0.770	1.00
40_N	43_L	0.770	1.00
66_A	83_R	0.762	1.00
14_M	19_T	0.762	1.00
101_L	117_V	0.757	1.00
152_V	173_F	0.755	1.00
20_R	23_I	0.752	1.00
62_I	87_P	0.742	1.00
37_T	134_A	0.742	1.00
29_R	38_P	0.739	1.00
53_F	107_L	0.736	1.00
100_D	103_L	0.726	1.00
40_N	44_I	0.724	1.00
148_I	177_L	0.719	1.00
108_A	120_R	0.719	1.00
19_T	127_V	0.718	1.00
103_L	106_D	0.717	1.00
93_L	96_T	0.714	1.00
99_K	102_A	0.714	1.00
103_L	107_L	0.696	1.00
87_P	90_E	0.695	1.00
11_I	15_M	0.694	1.00
19_T	42_V	0.693	1.00
123_I	127_V	0.690	1.00
59_F	67_L	0.690	1.00
103_L	189_G	0.689	1.00
104_F	121_V	0.688	1.00
164_L	169_I	0.687	1.00
133_T	136_Q	0.685	1.00
154_S	165_P	0.685	1.00
163_M	166_P	0.684	1.00
96_T	129_S	0.680	1.00
147_V	150_L	0.675	1.00
17_S	126_F	0.674	1.00
179_V	182_D	0.674	1.00
98_E	114_P	0.673	1.00
52_F	120_R	0.669	1.00
100_D	128_I	0.667	1.00
97_R	132_K	0.667	1.00
111_P	118_P	0.662	1.00
97_R	136_Q	0.662	1.00
92_M	95_Q	0.661	1.00
46_L	188_V	0.661	1.00
22_V	26_S	0.660	1.00
2_L	6_S	0.657	1.00
34_T	175_L	0.655	1.00
150_L	156_L	0.655	1.00
85_S	88_L	0.654	1.00
176_L	180_L	0.654	1.00
18_F	44_I	0.654	1.00
53_F	108_A	0.654	1.00
27_F	138_G	0.651	1.00
97_R	129_S	0.648	1.00
185_N	188_V	0.645	1.00
58_V	62_I	0.643	1.00
62_I	65_E	0.637	1.00
50_L	107_L	0.637	1.00
27_F	35_Q	0.635	1.00
120_R	124_P	0.634	1.00
30_Q	37_T	0.633	1.00
50_L	188_V	0.630	1.00
26_S	134_A	0.626	1.00
41_Q	44_I	0.620	1.00
39_P	156_L	0.617	1.00
142_F	171_L	0.617	1.00
92_M	96_T	0.614	1.00
80_A	84_A	0.613	1.00
12_L	48_L	0.612	1.00
59_F	62_I	0.609	1.00
7_L	13_I	0.609	1.00
130_E	133_T	0.608	1.00
26_S	36_Q	0.607	1.00
25_L	46_L	0.603	0.99
41_Q	45_G	0.602	0.99
103_L	124_P	0.601	0.99
30_Q	155_V	0.600	0.99
103_L	128_I	0.600	0.99
24_V	134_A	0.597	0.99
75_I	80_A	0.596	0.99
55_M	91_F	0.592	0.99
162_M	165_P	0.589	0.99
70_Y	75_I	0.586	0.99
102_A	105_V	0.585	0.99
25_L	188_V	0.584	0.99
34_T	38_P	0.581	0.99
23_I	27_F	0.580	0.99
17_S	51_T	0.579	0.99
105_V	117_V	0.577	0.99
25_L	187_L	0.576	0.99
112_A	115_E	0.576	0.99
76_T	82_E	0.575	0.99
95_Q	107_L	0.572	0.99
101_L	122_L	0.571	0.99
52_F	59_F	0.568	0.99
73_G	76_T	0.567	0.99
164_L	170_S	0.566	0.99
106_D	189_G	0.566	0.99
114_P	117_V	0.565	0.99
148_I	173_F	0.563	0.99
109_K	112_A	0.563	0.99
128_I	132_K	0.561	0.99
88_L	92_M	0.561	0.99
117_V	121_V	0.558	0.99
29_R	43_L	0.557	0.99
73_G	77_Q	0.556	0.99
74_E	109_K	0.555	0.99
186_L	189_G	0.554	0.99
161_M	166_P	0.553	0.99
95_Q	133_T	0.549	0.99
153_A	164_L	0.548	0.99
140_L	164_L	0.546	0.99
51_T	55_M	0.544	0.99
10_A	13_I	0.543	0.99
72_A	82_E	0.543	0.99
173_F	177_L	0.542	0.99
102_A	111_P	0.540	0.99
154_S	158_S	0.537	0.99
104_F	124_P	0.534	0.99
54_V	91_F	0.534	0.99
159_M	162_M	0.532	0.99
66_A	80_A	0.532	0.99
55_M	58_V	0.531	0.99
181_V	185_N	0.529	0.99
11_I	14_M	0.526	0.99
185_N	190_S	0.524	0.99
114_P	122_L	0.520	0.98
51_T	59_F	0.519	0.98
15_M	59_F	0.517	0.98
74_E	112_A	0.517	0.98
100_D	129_S	0.514	0.98
159_M	167_V	0.508	0.98
54_V	139_F	0.507	0.98
85_S	92_M	0.505	0.98
106_D	114_P	0.504	0.98
77_Q	85_S	0.504	0.98
30_Q	168_M	0.503	0.98
33_G	36_Q	0.501	0.98
171_L	175_L	0.501	0.98
16_T	51_T	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ww9B	1	0.3089	3.8	0.968	Contact Map
1w53A	2	0.4398	3.4	0.968	Contact Map
1rh5B	1	0.288	3.1	0.969	Contact Map
2f6mA	1	0.3298	2.6	0.97	Contact Map
4fdyA	1	0.3141	2.2	0.971	Contact Map
1mhsA	2	0.4869	1.6	0.974	Contact Map
4owtA	1	0.4921	1.6	0.974	Contact Map
3aqpA	1	0.2618	1.5	0.974	Contact Map
3mp7B	1	0.2775	1.5	0.974	Contact Map
4dx5A	3	0.3403	1.5	0.974	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.