Chitin_bind_4 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Chitin_bind_4 - Insect cuticle protein

PFAM:	PF00379	Sequences: YSFSYEVSDGISTQEEGRNAEEEDDGGVVKGSYSYVDPDGRTRTVTYTADENGF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	54 (52)
Sequences:	4765 (3039)
Seq/√Len:	421.4
META:	0.332

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_D	41_R	3.123	1.00
37_D	43_R	2.821	1.00
32_S	46_T	2.668	1.00
36_V	42_T	2.580	1.00
34_S	44_T	2.508	1.00
33_Y	45_V	2.414	1.00
28_V	50_D	1.895	1.00
32_S	44_T	1.892	1.00
48_T	52_N	1.765	1.00
35_Y	43_R	1.713	1.00
34_S	42_T	1.634	1.00
3_F	13_T	1.603	1.00
1_Y	29_V	1.518	1.00
22_E	25_D	1.394	1.00
1_Y	15_E	1.385	1.00
5_Y	13_T	1.338	1.00
7_V	11_I	1.324	1.00
21_E	24_D	1.183	1.00
29_V	47_Y	1.126	1.00
33_Y	47_Y	1.091	1.00
14_Q	17_G	1.067	1.00
35_Y	38_P	1.043	1.00
30_K	48_T	1.029	1.00
33_Y	54_F	1.013	1.00
12_S	34_S	0.992	1.00
35_Y	39_D	0.979	1.00
47_Y	54_F	0.965	1.00
24_D	28_V	0.963	1.00
36_V	41_R	0.933	1.00
6_E	12_S	0.928	1.00
24_D	27_G	0.917	1.00
21_E	25_D	0.905	1.00
3_F	47_Y	0.902	1.00
2_S	23_E	0.861	1.00
4_S	32_S	0.846	1.00
18_R	30_K	0.839	1.00
28_V	51_E	0.820	1.00
13_T	47_Y	0.811	1.00
30_K	46_T	0.770	1.00
37_D	42_T	0.747	1.00
23_E	27_G	0.743	1.00
5_Y	11_I	0.733	1.00
14_Q	18_R	0.719	1.00
2_S	16_E	0.707	1.00
18_R	27_G	0.695	1.00
26_G	51_E	0.684	1.00
39_D	43_R	0.681	1.00
25_D	30_K	0.675	1.00
45_V	54_F	0.670	1.00
18_R	24_D	0.648	0.99
7_V	10_G	0.647	0.99
22_E	26_G	0.631	0.99
3_F	33_Y	0.630	0.99
49_A	52_N	0.625	0.99
25_D	28_V	0.625	0.99
7_V	13_T	0.590	0.99
14_Q	32_S	0.576	0.99
37_D	54_F	0.574	0.99
23_E	26_G	0.573	0.98
28_V	48_T	0.572	0.98
21_E	27_G	0.570	0.98
2_S	22_E	0.566	0.98
29_V	49_A	0.559	0.98
8_S	15_E	0.558	0.98
4_S	14_Q	0.555	0.98
35_Y	54_F	0.552	0.98
38_P	41_R	0.549	0.98
25_D	41_R	0.548	0.98
26_G	29_V	0.539	0.98
5_Y	54_F	0.538	0.98
10_G	13_T	0.535	0.98
9_D	40_G	0.529	0.97
48_T	51_E	0.526	0.97
16_E	30_K	0.524	0.97
18_R	28_V	0.523	0.97
7_V	38_P	0.520	0.97
31_G	53_G	0.507	0.97
35_Y	42_T	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2g5dA	1	0.9815	13.2	0.8	Contact Map
2pnwA	1	0.9815	8.3	0.817	Contact Map
3czbA	2	0.9815	3.8	0.845	Contact Map
3klkA	1	0.4074	2.8	0.855	Contact Map
4r3oE	1	0.4815	2.5	0.859	Contact Map
2kt7A	1	0.3333	2.3	0.861	Contact Map
1rypE	1	0.463	2.3	0.861	Contact Map
3mfbA	1	0.9815	2.3	0.862	Contact Map
3a24A	1	0.4259	1.7	0.87	Contact Map
1xqaA	2	0.8148	1.7	0.871	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.