Q9HSZ5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSZ5 - Uncharacterized protein

UniProt:	Q9HSZ5	Sequences: MVGADSHSCTEGAIGAYSIGVGSTDLAFAMAFGWVWARVPETTRINYVGEPTGWVSGKDLERYRSLVFR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	69 (64)
Sequences:	844 (364)
Seq/√Len:	45.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_V	26_L	4.487	1.00
2_V	29_A	3.016	1.00
2_V	37_A	2.852	1.00
47_Y	60_L	2.481	1.00
45_I	64_R	2.469	1.00
21_V	35_V	2.417	1.00
51_P	60_L	2.368	1.00
11_E	18_S	2.124	1.00
21_V	25_D	2.016	0.99
54_W	57_G	1.991	0.99
21_V	29_A	1.822	0.99
51_P	55_V	1.821	0.99
14_I	23_S	1.721	0.98
47_Y	64_R	1.556	0.96
2_V	21_V	1.448	0.94
58_K	62_R	1.266	0.89
4_A	10_T	1.259	0.89
9_C	17_Y	1.250	0.89
8_S	18_S	1.244	0.89
51_P	57_G	1.236	0.88
45_I	63_Y	1.235	0.88
4_A	26_L	1.139	0.84
9_C	19_I	1.095	0.81
8_S	61_E	1.037	0.77
10_T	24_T	1.023	0.76
1_M	16_A	1.021	0.76
3_G	33_G	0.984	0.74
61_E	64_R	0.984	0.74
45_I	54_W	0.978	0.73
3_G	42_T	0.961	0.72
27_A	31_A	0.950	0.71
8_S	28_F	0.949	0.71
11_E	19_I	0.948	0.71
28_F	34_W	0.946	0.71
46_N	53_G	0.934	0.70
37_A	41_E	0.888	0.66
50_E	53_G	0.881	0.65
10_T	27_A	0.856	0.63
46_N	50_E	0.843	0.62
3_G	39_V	0.843	0.62
26_L	29_A	0.782	0.56
24_T	42_T	0.773	0.55
33_G	37_A	0.770	0.55
9_C	24_T	0.768	0.54
25_D	33_G	0.756	0.53
25_D	35_V	0.751	0.53
3_G	18_S	0.750	0.53
21_V	32_F	0.732	0.51
29_A	35_V	0.732	0.51
48_V	52_T	0.732	0.51
30_M	53_G	0.722	0.50
22_G	25_D	0.720	0.50
4_A	23_S	0.719	0.50
38_R	41_E	0.717	0.50
45_I	48_V	0.716	0.49
20_G	36_W	0.715	0.49
32_F	44_R	0.711	0.49
2_V	35_V	0.695	0.47
34_W	39_V	0.690	0.47
14_I	18_S	0.679	0.46
19_I	38_R	0.667	0.45
50_E	55_V	0.665	0.44
13_A	63_Y	0.657	0.44
33_G	39_V	0.657	0.44
13_A	45_I	0.643	0.42
4_A	30_M	0.642	0.42
3_G	41_E	0.642	0.42
29_A	48_V	0.638	0.42
8_S	24_T	0.631	0.41
15_G	53_G	0.610	0.39
13_A	34_W	0.601	0.38
36_W	39_V	0.600	0.38
11_E	37_A	0.597	0.38
1_M	26_L	0.594	0.38
10_T	58_K	0.593	0.38
50_E	63_Y	0.591	0.37
18_S	25_D	0.590	0.37
3_G	11_E	0.589	0.37
47_Y	63_Y	0.586	0.37
51_P	54_W	0.580	0.36
3_G	60_L	0.579	0.36
23_S	42_T	0.579	0.36
42_T	57_G	0.571	0.36
15_G	47_Y	0.563	0.35
31_A	37_A	0.562	0.35
24_T	33_G	0.560	0.35
27_A	58_K	0.560	0.35
2_V	14_I	0.543	0.33
16_A	56_S	0.540	0.33
1_M	43_T	0.529	0.32
15_G	26_L	0.527	0.32
51_P	63_Y	0.525	0.32
35_V	39_V	0.512	0.31
31_A	54_W	0.503	0.30
19_I	37_A	0.502	0.30
20_G	25_D	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kp1A	1	1	100	0.173	Contact Map
4kp2A	2	0.9855	100	0.192	Contact Map
1c96A	1	1	99.9	0.202	Contact Map
2b3yA	1	1	99.9	0.217	Contact Map
1l5jA	1	0.9565	99.9	0.319	Contact Map
3nioA	5	0.8986	9.7	0.921	Contact Map
1wohA	5	0.942	8.5	0.923	Contact Map
3g5sA	1	0.8696	8.3	0.924	Contact Map
4mykA	3	0.8261	7	0.926	Contact Map
2cevA	5	0.9565	6.5	0.927	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.