Q9HSX1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSX1 - Uncharacterized protein

UniProt:	Q9HSX1	Sequences: MGLAGVGRIQEGHTMPTLKVTVGKRDRLDQRTRSRIKAAQEGEDLDDAQPVLNFESYTELSRLLSPKNLELLETISEHDPESISEAAELVDRDYKQVHQNLSELEDIGVITFEHSDTGQAKQPKLAYDGLEIDIPFAGSNGSASTAAP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	148 (115)
Sequences:	343 (253)
Seq/√Len:	23.6

HALSA - Q9HSX1 O51955

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
101_L	123_P	3.846	1.00
68_N	100_N	3.761	1.00
67_K	70_E	3.261	1.00
71_L	86_A	3.134	1.00
35_R	39_A	2.617	0.99
82_S	123_P	2.439	0.98
78_H	89_L	2.191	0.96
75_I	110_I	2.075	0.95
37_K	40_Q	1.977	0.94
38_A	43_E	1.903	0.92
90_V	97_V	1.723	0.88
84_S	93_D	1.711	0.87
20_V	86_A	1.659	0.86
16_P	50_P	1.644	0.85
84_S	88_E	1.625	0.85
96_Q	99_Q	1.594	0.83
21_T	51_V	1.564	0.82
21_T	53_N	1.563	0.82
83_I	123_P	1.558	0.82
67_K	95_K	1.552	0.82
85_E	89_L	1.530	0.81
65_S	68_N	1.528	0.81
20_V	109_V	1.521	0.80
97_V	104_L	1.500	0.79
58_T	66_P	1.480	0.78
94_Y	98_H	1.467	0.78
84_S	94_Y	1.421	0.75
84_S	118_G	1.404	0.75
61_S	65_S	1.360	0.72
95_K	99_Q	1.344	0.71
84_S	106_D	1.325	0.70
93_D	118_G	1.315	0.69
18_L	67_K	1.307	0.69
40_Q	109_V	1.298	0.68
124_K	132_I	1.224	0.64
86_A	109_V	1.209	0.63
44_D	128_D	1.203	0.62
113_E	117_T	1.189	0.62
85_E	90_V	1.154	0.59
33_R	56_S	1.127	0.57
101_L	110_I	1.114	0.56
45_L	49_Q	1.087	0.55
26_D	42_G	1.080	0.54
31_R	39_A	1.071	0.53
78_H	119_Q	1.064	0.53
74_T	90_V	1.061	0.53
87_A	97_V	1.053	0.52
71_L	127_Y	1.045	0.52
109_V	124_K	1.030	0.51
24_K	114_H	1.028	0.50
23_G	34_S	1.027	0.50
90_V	100_N	1.024	0.50
107_I	125_L	1.022	0.50
112_F	123_P	1.020	0.50
77_E	125_L	1.013	0.49
54_F	64_L	1.012	0.49
87_A	118_G	1.010	0.49
125_L	134_I	1.008	0.49
27_R	47_D	1.002	0.49
24_K	27_R	0.996	0.48
17_T	118_G	0.983	0.47
88_E	118_G	0.971	0.46
73_E	78_H	0.968	0.46
56_S	73_E	0.967	0.46
106_D	111_T	0.955	0.45
31_R	72_L	0.954	0.45
69_L	87_A	0.954	0.45
100_N	103_E	0.945	0.45
75_I	82_S	0.945	0.45
71_L	82_S	0.935	0.44
94_Y	127_Y	0.925	0.43
65_S	100_N	0.918	0.43
82_S	101_L	0.915	0.42
48_A	53_N	0.895	0.41
52_L	129_G	0.891	0.41
61_S	132_I	0.889	0.41
56_S	59_E	0.889	0.41
75_I	123_P	0.888	0.41
24_K	70_E	0.884	0.40
43_E	113_E	0.882	0.40
96_Q	100_N	0.880	0.40
83_I	101_L	0.880	0.40
90_V	93_D	0.877	0.40
66_P	128_D	0.875	0.40
79_D	126_A	0.868	0.39
77_E	89_L	0.865	0.39
101_L	105_E	0.864	0.39
88_E	94_Y	0.861	0.39
58_T	73_E	0.858	0.39
20_V	130_L	0.857	0.39
43_E	58_T	0.854	0.38
56_S	117_T	0.852	0.38
131_E	134_I	0.849	0.38
111_T	130_L	0.845	0.38
114_H	126_A	0.831	0.37
69_L	104_L	0.828	0.37
126_A	130_L	0.827	0.37
57_Y	61_S	0.826	0.36
105_E	123_P	0.824	0.36
87_A	123_P	0.810	0.35
101_L	112_F	0.806	0.35
36_I	56_S	0.801	0.35
36_I	40_Q	0.795	0.34
68_N	126_A	0.782	0.34
56_S	64_L	0.755	0.32
84_S	90_V	0.754	0.32
75_I	80_P	0.752	0.32
26_D	62_R	0.737	0.31
32_T	36_I	0.734	0.31
94_Y	109_V	0.732	0.31
83_I	102_S	0.723	0.30
18_L	85_E	0.720	0.30
35_R	97_V	0.718	0.30
65_S	103_E	0.713	0.29
49_Q	69_L	0.710	0.29
32_T	51_V	0.704	0.29
54_F	65_S	0.703	0.29
55_E	111_T	0.702	0.29
98_H	102_S	0.695	0.28
70_E	134_I	0.693	0.28
50_P	55_E	0.687	0.28
96_Q	103_E	0.687	0.28
57_Y	118_G	0.681	0.28
47_D	94_Y	0.681	0.28
80_P	123_P	0.680	0.28
80_P	135_P	0.679	0.28
22_V	53_N	0.679	0.28
68_N	90_V	0.675	0.27
75_I	124_K	0.670	0.27
32_T	43_E	0.668	0.27
84_S	132_I	0.653	0.26
107_I	130_L	0.646	0.26
19_K	131_E	0.637	0.25
70_E	106_D	0.636	0.25
16_P	82_S	0.622	0.24
16_P	137_A	0.616	0.24
26_D	35_R	0.614	0.24
68_N	101_L	0.609	0.24
80_P	137_A	0.608	0.24
75_I	102_S	0.606	0.24
73_E	118_G	0.605	0.24
37_K	41_E	0.599	0.23
82_S	119_Q	0.597	0.23
18_L	132_I	0.587	0.23
81_E	87_A	0.581	0.22
55_E	127_Y	0.579	0.22
57_Y	132_I	0.578	0.22
18_L	52_L	0.571	0.22
113_E	119_Q	0.571	0.22
16_P	24_K	0.570	0.22
127_Y	130_L	0.569	0.22
82_S	99_Q	0.565	0.22
33_R	43_E	0.563	0.22
77_E	113_E	0.561	0.21
44_D	114_H	0.557	0.21
127_Y	133_D	0.556	0.21
70_E	102_S	0.554	0.21
25_R	70_E	0.553	0.21
32_T	57_Y	0.540	0.20
60_L	93_D	0.537	0.20
77_E	137_A	0.535	0.20
48_A	110_I	0.535	0.20
68_N	86_A	0.533	0.20
51_V	64_L	0.527	0.20
75_I	105_E	0.522	0.20
34_S	38_A	0.519	0.19
104_L	118_G	0.507	0.19
18_L	72_L	0.506	0.19
105_E	134_I	0.504	0.19
62_R	70_E	0.502	0.19
67_K	134_I	0.502	0.19
52_L	136_F	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lb6B	2	0.4257	97.5	0.835	Contact Map
1u2wA	2	0.7297	97.4	0.838	Contact Map
2p4wA	2	0.6419	97.3	0.839	Contact Map
1r1uA	2	0.6554	97.3	0.84	Contact Map
2oqgA	4	0.6622	97.2	0.842	Contact Map
2fu4A	2	0.473	97.1	0.844	Contact Map
2lkpA	2	0.7432	97.1	0.845	Contact Map
3pqkA	2	0.6689	97.1	0.845	Contact Map
4k2eA	2	0.6351	97	0.846	Contact Map
1i1gA	5	0.527	96.9	0.848	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.