Q9HSW8 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSW8 - Uncharacterized protein

UniProt:	Q9HSW8	Sequences: MEYHLQTGSHTVYALQYHFVTVTKYRADILTYERLERVAEIAHDIADDFEADIKNVDGGTDHVHILFQTKPTTDLTKFINSLKGVTSRRIRSEFPEVTQTLEDAFWQPGYFLATTGQVSIDTLMDYVDDQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	130 (123)
Sequences:	1729 (1152)
Seq/√Len:	103.9

HALSA - Q9HSW8 Q9HM86 Q9HHX7 Q9HSD5
SULSO - Q97Y68

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_R	93_E	4.622	1.00
37_R	94_F	2.830	1.00
42_A	82_L	2.413	1.00
17_Y	69_T	2.299	1.00
41_I	86_T	2.276	1.00
55_N	128_D	2.103	1.00
42_A	86_T	2.083	1.00
19_F	79_I	1.923	1.00
51_A	78_F	1.884	1.00
69_T	75_L	1.856	1.00
19_F	67_F	1.809	1.00
17_Y	114_T	1.782	1.00
125_D	129_D	1.746	1.00
37_R	40_E	1.723	1.00
89_R	92_S	1.719	1.00
49_F	81_S	1.719	1.00
88_R	92_S	1.714	1.00
13_Y	112_L	1.707	1.00
66_L	127_V	1.692	1.00
22_V	107_Q	1.663	1.00
91_R	103_D	1.549	1.00
125_D	128_D	1.542	1.00
37_R	41_I	1.539	1.00
120_I	124_M	1.527	1.00
77_K	80_N	1.510	1.00
39_A	43_H	1.466	1.00
67_F	78_F	1.459	1.00
15_L	69_T	1.450	1.00
87_S	91_R	1.446	1.00
30_L	105_F	1.421	1.00
46_A	53_I	1.398	1.00
38_V	90_I	1.378	1.00
45_I	85_V	1.366	1.00
50_E	72_T	1.365	1.00
45_I	49_F	1.361	0.99
8_G	11_T	1.341	0.99
35_L	39_A	1.328	0.99
27_A	101_L	1.307	0.99
70_K	73_T	1.304	0.99
66_L	120_I	1.289	0.99
52_D	68_Q	1.280	0.99
15_L	112_L	1.275	0.99
22_V	26_R	1.271	0.99
121_D	124_M	1.256	0.99
124_M	128_D	1.246	0.99
30_L	38_V	1.226	0.99
69_T	78_F	1.218	0.99
17_Y	112_L	1.215	0.99
115_T	120_I	1.206	0.99
41_I	85_V	1.163	0.98
17_Y	75_L	1.152	0.98
15_L	75_L	1.113	0.98
97_V	103_D	1.113	0.98
41_I	89_R	1.112	0.98
119_S	122_T	1.092	0.98
46_A	82_L	1.088	0.98
76_T	110_Y	1.087	0.98
43_H	47_D	1.075	0.97
8_G	13_Y	1.066	0.97
19_F	75_L	1.065	0.97
39_A	57_D	1.062	0.97
34_R	96_E	1.056	0.97
71_P	76_T	1.053	0.97
46_A	51_A	1.046	0.97
75_L	112_L	1.046	0.97
42_A	56_V	1.029	0.97
46_A	65_I	1.028	0.97
87_S	103_D	1.015	0.96
74_D	77_K	1.008	0.96
42_A	63_V	0.989	0.96
44_D	48_D	0.988	0.96
39_A	58_G	0.977	0.95
75_L	79_I	0.971	0.95
55_N	124_M	0.964	0.95
19_F	112_L	0.960	0.95
16_Q	115_T	0.950	0.95
81_S	85_V	0.949	0.95
44_D	47_D	0.939	0.94
46_A	78_F	0.933	0.94
41_I	45_I	0.933	0.94
13_Y	68_Q	0.930	0.94
38_V	42_A	0.923	0.94
18_H	115_T	0.923	0.94
73_T	78_F	0.921	0.94
34_R	90_I	0.899	0.93
51_A	73_T	0.889	0.92
66_L	115_T	0.886	0.92
16_Q	68_Q	0.885	0.92
106_W	110_Y	0.881	0.92
14_A	113_A	0.877	0.92
39_A	56_V	0.870	0.92
116_G	119_S	0.857	0.91
122_T	125_D	0.850	0.91
80_N	108_P	0.847	0.90
58_G	63_V	0.831	0.90
37_R	90_I	0.827	0.89
35_L	59_G	0.820	0.89
91_R	98_T	0.817	0.89
16_Q	54_K	0.816	0.89
30_L	90_I	0.815	0.89
40_E	47_D	0.809	0.88
33_E	37_R	0.805	0.88
67_F	75_L	0.804	0.88
40_E	90_I	0.798	0.88
45_I	81_S	0.794	0.87
41_I	44_D	0.783	0.87
98_T	101_L	0.774	0.86
28_D	61_D	0.771	0.86
30_L	35_L	0.771	0.86
15_L	114_T	0.764	0.85
81_S	84_G	0.763	0.85
67_F	112_L	0.762	0.85
46_A	84_G	0.756	0.85
87_S	104_A	0.753	0.85
21_T	67_F	0.752	0.84
35_L	57_D	0.750	0.84
11_T	15_L	0.744	0.84
74_D	79_I	0.743	0.84
42_A	65_I	0.740	0.83
90_I	93_E	0.737	0.83
91_R	104_A	0.718	0.82
77_K	81_S	0.716	0.81
13_Y	17_Y	0.715	0.81
14_A	111_F	0.715	0.81
119_S	127_V	0.705	0.80
35_L	58_G	0.699	0.80
43_H	53_I	0.692	0.79
14_A	68_Q	0.688	0.79
95_P	98_T	0.681	0.78
118_V	123_L	0.675	0.77
97_V	101_L	0.674	0.77
32_Y	36_E	0.668	0.77
39_A	59_G	0.659	0.76
30_L	34_R	0.656	0.75
70_K	76_T	0.655	0.75
80_N	84_G	0.653	0.75
103_D	107_Q	0.640	0.74
9_S	109_G	0.640	0.74
40_E	44_D	0.639	0.74
13_Y	71_P	0.639	0.74
35_L	56_V	0.631	0.73
42_A	53_I	0.622	0.72
55_N	63_V	0.610	0.70
41_I	78_F	0.608	0.70
113_A	119_S	0.607	0.70
101_L	104_A	0.607	0.70
70_K	74_D	0.605	0.69
121_D	125_D	0.604	0.69
50_E	70_K	0.601	0.69
53_I	67_F	0.599	0.69
84_G	91_R	0.597	0.68
30_L	58_G	0.593	0.68
113_A	118_V	0.593	0.68
54_K	68_Q	0.592	0.68
44_D	89_R	0.592	0.68
36_E	40_E	0.587	0.67
8_G	70_K	0.572	0.65
51_A	79_I	0.565	0.64
10_H	109_G	0.564	0.64
18_H	62_H	0.563	0.64
84_G	104_A	0.562	0.64
16_Q	120_I	0.557	0.63
18_H	64_H	0.556	0.63
74_D	114_T	0.555	0.63
49_F	85_V	0.549	0.62
84_G	88_R	0.548	0.62
84_G	87_S	0.545	0.61
104_A	108_P	0.544	0.61
48_D	85_V	0.536	0.60
25_Y	105_F	0.531	0.59
47_D	53_I	0.531	0.59
66_L	118_V	0.531	0.59
85_V	89_R	0.524	0.58
31_T	35_L	0.520	0.58
118_V	122_T	0.519	0.58
16_Q	66_L	0.519	0.58
45_I	48_D	0.518	0.58
91_R	95_P	0.513	0.57
33_E	36_E	0.512	0.57
99_Q	102_E	0.512	0.57
127_V	130_Q	0.511	0.57
117_Q	120_I	0.510	0.56
15_L	80_N	0.502	0.55
85_V	88_R	0.500	0.55

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vjvA	2	0.9538	100	0.33	Contact Map
2f5gA	2	0.9538	100	0.354	Contact Map
2fyxA	2	0.9615	100	0.361	Contact Map
4er8A	1	0.9	99.9	0.494	Contact Map
4re1A	1	0.6	20.3	0.937	Contact Map
4nrdA	3	0.5769	19.7	0.937	Contact Map
1jnpA	2	0.2385	17.8	0.938	Contact Map
3l15A	1	0.5692	12	0.943	Contact Map
3knyA	2	0.6923	10.2	0.945	Contact Map
2ii1A	2	0.7154	8.4	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.