Q9HSW0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSW0 - Uncharacterized protein

UniProt:	Q9HSW0	Sequences: MTEAALDASEQFPHKRLVVHYMQPHYPFVPGDTDFDKEHLQQIDGEGSEPSAENVWAQKFRGSLDVSQEDLWSIYTDNLEYALENVEDLLDGLTGKTVVTSDHGNYVGERASLIPIQEYGHPRGLYDPPVVQIPWFEYEQGSRRIIRQGDG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (130)
Sequences:	199 (175)
Seq/√Len:	15.3

HALSA - Q9HSW0 Q9HQP7 Q9HNT9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
2_T	21_Y	6.697	1.00
56_W	105_N	3.805	1.00
5_A	19_V	3.471	0.99
106_Y	127_D	3.438	0.99
28_F	105_N	3.198	0.99
30_P	77_D	2.841	0.97
59_K	71_L	2.321	0.91
67_S	70_D	2.270	0.90
5_A	17_L	2.117	0.87
90_L	142_S	2.099	0.86
90_L	97_T	2.067	0.86
33_T	77_D	2.007	0.84
105_N	122_P	1.982	0.83
56_W	120_G	1.972	0.83
29_V	81_Y	1.712	0.73
125_L	130_V	1.708	0.72
58_Q	62_G	1.702	0.72
21_Y	97_T	1.700	0.72
84_E	90_L	1.626	0.68
72_W	105_N	1.593	0.67
75_Y	105_N	1.573	0.66
13_P	143_R	1.550	0.65
87_E	90_L	1.502	0.62
96_K	144_R	1.502	0.62
26_Y	105_N	1.476	0.61
55_V	107_V	1.452	0.59
72_W	107_V	1.388	0.56
12_F	15_K	1.347	0.54
105_N	120_G	1.347	0.54
130_V	137_E	1.333	0.53
86_V	91_D	1.303	0.51
61_R	69_E	1.280	0.50
106_Y	125_L	1.266	0.49
18_V	69_E	1.260	0.49
22_M	105_N	1.255	0.48
6_L	92_G	1.235	0.47
15_K	95_G	1.235	0.47
61_R	130_V	1.233	0.47
28_F	56_W	1.232	0.47
4_A	7_D	1.232	0.47
30_P	81_Y	1.214	0.46
15_K	143_R	1.208	0.46
96_K	143_R	1.207	0.46
62_G	122_P	1.167	0.43
18_V	78_N	1.163	0.43
98_V	130_V	1.161	0.43
82_A	99_V	1.159	0.43
92_G	142_S	1.149	0.42
13_P	98_V	1.148	0.42
138_Y	141_G	1.132	0.41
78_N	105_N	1.127	0.41
60_F	145_I	1.127	0.41
47_G	101_S	1.122	0.41
99_V	136_F	1.117	0.41
81_Y	100_T	1.113	0.40
15_K	106_Y	1.111	0.40
106_Y	109_E	1.095	0.39
56_W	62_G	1.092	0.39
61_R	100_T	1.084	0.39
18_V	128_P	1.083	0.39
67_S	105_N	1.068	0.38
56_W	72_W	1.060	0.38
57_A	67_S	1.058	0.37
66_V	76_T	1.056	0.37
101_S	111_A	1.029	0.36
106_Y	130_V	1.026	0.36
29_V	96_K	1.017	0.35
18_V	145_I	1.015	0.35
11_Q	69_E	1.015	0.35
9_S	140_Q	1.012	0.35
26_Y	120_G	0.999	0.34
97_T	140_Q	0.998	0.34
54_N	66_V	0.992	0.34
2_T	92_G	0.992	0.34
11_Q	62_G	0.975	0.33
79_L	89_L	0.972	0.33
71_L	118_E	0.964	0.33
21_Y	85_N	0.935	0.31
14_H	97_T	0.924	0.31
17_L	124_G	0.920	0.30
26_Y	56_W	0.912	0.30
17_L	50_P	0.901	0.29
54_N	58_Q	0.895	0.29
18_V	57_A	0.891	0.29
93_L	97_T	0.886	0.29
82_A	92_G	0.885	0.29
36_D	144_R	0.879	0.28
12_F	143_R	0.847	0.27
60_F	123_R	0.846	0.27
14_H	21_Y	0.844	0.27
32_D	77_D	0.841	0.27
12_F	96_K	0.837	0.27
50_P	54_N	0.817	0.26
9_S	93_L	0.816	0.26
139_E	142_S	0.807	0.25
96_K	137_E	0.804	0.25
16_R	143_R	0.801	0.25
10_E	88_D	0.797	0.25
2_T	89_L	0.793	0.25
10_E	138_Y	0.787	0.24
2_T	85_N	0.777	0.24
15_K	110_R	0.762	0.23
2_T	5_A	0.758	0.23
99_V	139_E	0.752	0.23
128_P	132_Q	0.752	0.23
94_T	138_Y	0.751	0.23
34_D	77_D	0.743	0.23
106_Y	118_E	0.738	0.22
94_T	109_E	0.737	0.22
62_G	126_Y	0.729	0.22
82_A	140_Q	0.728	0.22
66_V	132_Q	0.721	0.22
2_T	97_T	0.714	0.21
90_L	138_Y	0.712	0.21
87_E	104_G	0.703	0.21
28_F	48_S	0.700	0.21
33_T	78_N	0.697	0.21
31_G	77_D	0.681	0.20
91_D	99_V	0.680	0.20
71_L	119_Y	0.680	0.20
21_Y	119_Y	0.679	0.20
39_H	101_S	0.671	0.20
60_F	70_D	0.670	0.20
15_K	126_Y	0.670	0.20
29_V	61_R	0.667	0.20
15_K	97_T	0.659	0.19
68_Q	105_N	0.658	0.19
55_V	59_K	0.657	0.19
10_E	95_G	0.645	0.19
28_F	74_I	0.642	0.19
55_V	58_Q	0.640	0.19
17_L	101_S	0.634	0.19
6_L	88_D	0.633	0.19
69_E	137_E	0.631	0.18
80_E	101_S	0.625	0.18
31_G	100_T	0.620	0.18
57_A	73_S	0.618	0.18
4_A	9_S	0.617	0.18
61_R	65_D	0.614	0.18
7_D	145_I	0.612	0.18
65_D	83_L	0.609	0.18
65_D	90_L	0.605	0.18
71_L	105_N	0.605	0.18
13_P	144_R	0.604	0.18
26_Y	37_K	0.604	0.18
60_F	71_L	0.603	0.18
58_Q	66_V	0.602	0.17
76_T	107_V	0.602	0.17
74_I	110_R	0.597	0.17
22_M	79_L	0.592	0.17
21_Y	138_Y	0.592	0.17
51_S	60_F	0.590	0.17
30_P	33_T	0.589	0.17
18_V	107_V	0.589	0.17
70_D	125_L	0.578	0.17
53_E	111_A	0.578	0.17
57_A	132_Q	0.576	0.17
66_V	123_R	0.572	0.17
4_A	8_A	0.571	0.17
88_D	99_V	0.571	0.17
13_P	93_L	0.570	0.16
58_Q	65_D	0.570	0.16
70_D	137_E	0.570	0.16
2_T	10_E	0.569	0.16
2_T	99_V	0.568	0.16
29_V	137_E	0.568	0.16
17_L	119_Y	0.565	0.16
65_D	101_S	0.553	0.16
95_G	127_D	0.550	0.16
66_V	71_L	0.550	0.16
31_G	96_K	0.549	0.16
67_S	71_L	0.548	0.16
91_D	106_Y	0.546	0.16
57_A	119_Y	0.542	0.16
8_A	13_P	0.540	0.16
47_G	100_T	0.540	0.16
48_S	107_V	0.539	0.16
110_R	144_R	0.534	0.15
37_K	105_N	0.534	0.15
62_G	105_N	0.533	0.15
70_D	94_T	0.532	0.15
5_A	137_E	0.532	0.15
49_E	80_E	0.526	0.15
35_F	96_K	0.525	0.15
106_Y	129_P	0.523	0.15
13_P	96_K	0.523	0.15
101_S	137_E	0.521	0.15
95_G	143_R	0.517	0.15
111_A	133_I	0.516	0.15
49_E	132_Q	0.511	0.15
15_K	144_R	0.507	0.15
6_L	93_L	0.503	0.14
7_D	118_E	0.502	0.14
94_T	104_G	0.502	0.14
3_E	6_L	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4upkA	3	0.9338	98.9	0.808	Contact Map
2vqrA	3	0.947	98.9	0.811	Contact Map
4upiA	2	0.947	98.9	0.812	Contact Map
2qzuA	2	0.9205	98.8	0.818	Contact Map
4uplA	2	0.9404	98.7	0.819	Contact Map
4uphA	2	0.9404	98.7	0.825	Contact Map
1fsuA	1	0.8079	98.6	0.826	Contact Map
4tn0A	1	0.8543	98.6	0.827	Contact Map
3b5qA	1	0.9404	98.6	0.828	Contact Map
4kavA	1	0.8675	98.6	0.829	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.