Q9HSV8 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSV8 - Uncharacterized protein

UniProt:	Q9HSV8	Sequences: MLSLTGLPPDEIIRHQGEQEDDLNNTVWTDPDEPDFTTALNDALSRVLDGGTVVVSSVAYSWDGTTVSVPEQDVTITSHAETQKRWWD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	88 (71)
Sequences:	2995 (2738)
Seq/√Len:	324.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_S	70_P	4.456	1.00
51_G	69_V	4.118	1.00
68_S	78_S	3.438	1.00
71_E	75_T	3.133	1.00
56_S	72_Q	2.725	1.00
80_A	83_Q	2.457	1.00
69_V	79_H	1.953	1.00
59_A	68_S	1.780	1.00
51_G	73_D	1.747	1.00
81_E	84_K	1.504	1.00
58_V	67_V	1.450	1.00
14_R	17_G	1.427	1.00
15_H	19_Q	1.387	1.00
56_S	60_Y	1.374	1.00
53_V	56_S	1.354	1.00
60_Y	67_V	1.289	1.00
35_D	38_T	1.266	1.00
54_V	72_Q	1.253	1.00
60_Y	81_E	1.217	1.00
68_S	72_Q	1.206	1.00
56_S	76_I	1.185	1.00
18_E	21_D	1.180	1.00
22_D	26_T	1.144	1.00
51_G	55_V	1.141	1.00
60_Y	66_T	1.092	1.00
61_S	64_G	1.086	1.00
34_P	37_T	1.086	1.00
71_E	79_H	1.074	1.00
25_N	35_D	1.067	1.00
24_N	28_W	1.066	1.00
66_T	80_A	1.055	1.00
63_D	66_T	1.043	1.00
61_S	65_T	1.040	1.00
50_G	79_H	1.028	1.00
25_N	32_D	1.013	1.00
67_V	81_E	0.989	1.00
53_V	72_Q	0.987	1.00
19_Q	23_L	0.981	1.00
17_G	25_N	0.974	1.00
25_N	30_D	0.972	1.00
17_G	27_V	0.947	1.00
54_V	74_V	0.939	1.00
69_V	77_T	0.925	1.00
35_D	39_A	0.889	1.00
55_V	69_V	0.847	1.00
21_D	27_V	0.840	1.00
31_P	34_P	0.827	1.00
15_H	18_E	0.821	1.00
70_P	76_I	0.808	1.00
69_V	76_I	0.807	1.00
22_D	25_N	0.806	1.00
27_V	31_P	0.793	1.00
69_V	73_D	0.789	1.00
19_Q	29_T	0.788	1.00
30_D	35_D	0.788	1.00
15_H	23_L	0.764	1.00
22_D	30_D	0.748	0.99
28_W	32_D	0.741	0.99
22_D	28_W	0.733	0.99
14_R	19_Q	0.733	0.99
51_G	71_E	0.708	0.99
44_L	47_V	0.703	0.99
48_L	55_V	0.700	0.99
68_S	76_I	0.698	0.99
55_V	58_V	0.696	0.99
42_D	46_R	0.690	0.99
20_E	25_N	0.687	0.99
15_H	22_D	0.684	0.99
62_W	78_S	0.680	0.99
66_T	81_E	0.680	0.99
42_D	52_T	0.675	0.99
43_A	46_R	0.666	0.99
27_V	30_D	0.666	0.99
65_T	82_T	0.660	0.99
38_T	41_N	0.650	0.98
27_V	35_D	0.646	0.98
26_T	36_F	0.641	0.98
26_T	33_E	0.632	0.98
59_A	62_W	0.615	0.98
60_Y	64_G	0.612	0.98
56_S	59_A	0.610	0.98
34_P	38_T	0.610	0.98
61_S	68_S	0.595	0.97
26_T	30_D	0.587	0.97
14_R	20_E	0.584	0.97
19_Q	28_W	0.578	0.97
16_Q	22_D	0.578	0.97
28_W	31_P	0.576	0.97
21_D	33_E	0.576	0.97
18_E	23_L	0.574	0.97
46_R	65_T	0.569	0.96
60_Y	72_Q	0.565	0.96
16_Q	23_L	0.564	0.96
47_V	50_G	0.561	0.96
36_F	41_N	0.560	0.96
60_Y	63_D	0.555	0.96
36_F	39_A	0.553	0.96
21_D	24_N	0.552	0.96
61_S	66_T	0.551	0.96
25_N	29_T	0.539	0.95
38_T	43_A	0.533	0.95
42_D	45_S	0.526	0.94
21_D	34_P	0.516	0.94
69_V	74_V	0.514	0.94
19_Q	25_N	0.513	0.94
33_E	49_D	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1gotB	1	0.9886	99	0.37	Contact Map
3j60g	1	1	98.9	0.376	Contact Map
2pbiB	1	1	98.9	0.383	Contact Map
4u1eI	1	0.5227	98.9	0.386	Contact Map
4j0wA	1	0.5682	98.9	0.392	Contact Map
1vyhC	1	0.6023	98.8	0.399	Contact Map
4j73A	1	0.5455	98.8	0.402	Contact Map
4yhcA	1	0.7273	98.8	0.412	Contact Map
4j87A	1	0.5341	98.7	0.421	Contact Map
4u7aA	1	0.6591	98.7	0.423	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.