Q9HSU3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSU3 - Uncharacterized protein

UniProt:	Q9HSU3	Sequences: MTVLVDTGVLYADHDTDAARHEAAAGALDAVYDGEFGQPYVSDYLYDEAVTLALARSSSFDVAQRLGRRLRGADPYPETYRMLDVTTAVFDDAVGVFERLDDQQLSFTDATTVALMRRHDVDGVLSFDDDFDGLVDRLDPAAVV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	144 (124)
Sequences:	449 (387)
Seq/√Len:	34.7

HALSA - Q9HSU3 Q9HHH5 Q9HHY6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
68_R	98_E	4.002	1.00
9_V	125_L	3.339	1.00
42_S	115_L	3.276	1.00
89_V	118_R	3.155	1.00
113_V	124_V	3.001	1.00
47_D	108_T	2.984	1.00
105_L	134_L	2.845	1.00
11_Y	52_L	2.649	1.00
103_Q	133_G	2.637	1.00
4_L	112_T	2.594	1.00
24_A	127_F	2.524	1.00
5_V	10_L	2.488	1.00
47_D	51_T	2.319	0.99
93_A	111_T	2.187	0.99
106_S	130_D	1.905	0.97
126_S	132_D	1.848	0.97
42_S	112_T	1.840	0.97
5_V	9_V	1.798	0.96
11_Y	15_D	1.743	0.96
12_A	18_A	1.716	0.95
10_L	49_A	1.686	0.95
93_A	107_F	1.658	0.94
97_F	110_A	1.619	0.94
7_T	11_Y	1.606	0.93
51_T	106_S	1.573	0.93
113_V	116_M	1.545	0.92
96_V	114_A	1.499	0.91
67_G	94_V	1.491	0.90
63_A	93_A	1.448	0.89
116_M	124_V	1.447	0.89
105_L	133_G	1.407	0.88
112_T	124_V	1.406	0.88
50_V	106_S	1.397	0.87
107_F	111_T	1.384	0.87
51_T	97_F	1.368	0.86
112_T	130_D	1.347	0.85
105_L	113_V	1.343	0.85
46_Y	67_G	1.324	0.84
4_L	41_V	1.277	0.82
10_L	41_V	1.260	0.81
4_L	42_S	1.249	0.81
44_Y	47_D	1.234	0.80
38_Q	81_R	1.218	0.79
102_D	133_G	1.211	0.78
84_D	90_F	1.202	0.78
43_D	90_F	1.201	0.78
85_V	111_T	1.170	0.76
15_D	57_S	1.168	0.76
107_F	126_S	1.158	0.75
93_A	116_M	1.153	0.75
51_T	108_T	1.152	0.75
22_E	26_G	1.117	0.73
95_G	120_D	1.095	0.71
13_D	28_L	1.090	0.71
105_L	110_A	1.086	0.70
130_D	133_G	1.058	0.68
92_D	117_R	1.058	0.68
128_D	131_F	0.988	0.63
113_V	134_L	0.978	0.62
52_L	56_R	0.978	0.62
27_A	125_L	0.949	0.60
83_L	119_H	0.937	0.59
115_L	120_D	0.936	0.59
4_L	10_L	0.929	0.58
5_V	8_G	0.918	0.57
5_V	70_L	0.879	0.54
40_Y	83_L	0.879	0.54
111_T	116_M	0.870	0.53
49_A	66_L	0.862	0.52
70_L	99_R	0.860	0.52
42_S	116_M	0.857	0.52
25_A	66_L	0.852	0.52
63_A	97_F	0.850	0.51
20_R	23_A	0.847	0.51
100_L	134_L	0.845	0.51
3_V	93_A	0.840	0.51
51_T	107_F	0.826	0.49
92_D	95_G	0.822	0.49
16_T	33_D	0.822	0.49
47_D	106_S	0.817	0.49
43_D	84_D	0.811	0.48
112_T	116_M	0.809	0.48
54_L	126_S	0.805	0.48
108_T	130_D	0.802	0.47
43_D	111_T	0.797	0.47
110_A	130_D	0.794	0.47
10_L	42_S	0.791	0.46
110_A	113_V	0.789	0.46
9_V	28_L	0.777	0.45
67_G	71_R	0.777	0.45
40_Y	92_D	0.771	0.45
43_D	85_V	0.770	0.45
86_T	98_E	0.766	0.44
26_G	30_A	0.765	0.44
115_L	130_D	0.763	0.44
70_L	118_R	0.738	0.42
11_Y	49_A	0.738	0.42
11_Y	71_R	0.735	0.42
65_R	95_G	0.732	0.41
41_V	45_L	0.721	0.41
106_S	134_L	0.715	0.40
3_V	132_D	0.712	0.40
13_D	18_A	0.712	0.40
7_T	102_D	0.710	0.40
44_Y	106_S	0.709	0.40
9_V	52_L	0.696	0.38
52_L	97_F	0.693	0.38
17_D	108_T	0.687	0.38
5_V	79_T	0.683	0.37
51_T	54_L	0.679	0.37
71_R	91_D	0.677	0.37
62_V	120_D	0.677	0.37
71_R	94_V	0.674	0.37
29_D	88_A	0.669	0.36
3_V	40_Y	0.667	0.36
5_V	127_F	0.666	0.36
63_A	103_Q	0.666	0.36
89_V	119_H	0.659	0.36
43_D	108_T	0.655	0.35
64_Q	94_V	0.653	0.35
32_Y	68_R	0.653	0.35
100_L	105_L	0.651	0.35
86_T	120_D	0.643	0.34
20_R	127_F	0.643	0.34
41_V	118_R	0.642	0.34
25_A	29_D	0.637	0.34
17_D	68_R	0.625	0.33
22_E	69_R	0.620	0.33
30_A	121_V	0.619	0.32
50_V	66_L	0.615	0.32
70_L	122_D	0.613	0.32
23_A	46_Y	0.612	0.32
130_D	134_L	0.599	0.31
63_A	106_S	0.599	0.31
56_R	106_S	0.593	0.31
22_E	70_L	0.586	0.30
7_T	52_L	0.582	0.30
24_A	38_Q	0.580	0.30
27_A	31_V	0.580	0.30
19_A	31_V	0.579	0.30
45_L	68_R	0.578	0.29
53_A	124_V	0.570	0.29
24_A	83_L	0.568	0.29
47_D	97_F	0.567	0.29
16_T	26_G	0.567	0.29
105_L	114_A	0.566	0.29
34_G	83_L	0.564	0.29
41_V	83_L	0.563	0.28
7_T	108_T	0.563	0.28
44_Y	90_F	0.562	0.28
9_V	15_D	0.562	0.28
114_A	120_D	0.562	0.28
33_D	41_V	0.561	0.28
22_E	120_D	0.560	0.28
14_H	27_A	0.555	0.28
29_D	117_R	0.554	0.28
18_A	82_M	0.551	0.28
50_V	97_F	0.551	0.28
96_V	100_L	0.550	0.28
23_A	120_D	0.547	0.27
71_R	95_G	0.543	0.27
103_Q	113_V	0.540	0.27
92_D	118_R	0.532	0.26
45_L	112_T	0.532	0.26
65_R	69_R	0.531	0.26
19_A	64_Q	0.529	0.26
45_L	114_A	0.528	0.26
71_R	98_E	0.527	0.26
40_Y	119_H	0.526	0.26
125_L	132_D	0.526	0.26
124_V	134_L	0.525	0.26
105_L	124_V	0.523	0.26
29_D	64_Q	0.523	0.26
50_V	63_A	0.522	0.26
106_S	127_F	0.521	0.26
9_V	126_S	0.516	0.25
109_D	128_D	0.513	0.25
98_E	101_D	0.511	0.25
4_L	9_V	0.511	0.25
8_G	127_F	0.508	0.25
55_A	63_A	0.505	0.25
46_Y	90_F	0.505	0.25
17_D	91_D	0.505	0.25
10_L	43_D	0.502	0.24
51_T	116_M	0.501	0.24
9_V	132_D	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1w8iA	2	0.9375	99.8	0.57	Contact Map
2fe1A	2	0.8472	99.5	0.658	Contact Map
3zvkA	3	0.9028	99.5	0.659	Contact Map
3tndA	3	0.8819	99.5	0.668	Contact Map
2h1cA	2	0.9236	99.4	0.681	Contact Map
3dboB	1	0.8472	99.4	0.687	Contact Map
4chgA	2	0.8611	99.3	0.694	Contact Map
1v8pA	4	0.8264	99.2	0.71	Contact Map
3h87A	3	0.8681	99.2	0.712	Contact Map
1v96A	2	0.8681	99	0.741	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.