Q9HSU2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSU2 - Uncharacterized protein

UniProt:	Q9HSU2	Sequences: MGIPTHSDCTRRNVIQANIRAAESDVTGETFNVGTGGRVTVNELVDAPGTDIDQIYDDPRPGDVRHSHADISKAENLLGYEPEVGFTGGLEQTIPYCR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	98 (96)
Sequences:	1871 (1484)
Seq/√Len:	151.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_E	73_K	3.276	1.00
31_F	77_L	2.970	1.00
75_E	81_E	2.967	1.00
42_N	56_Y	2.900	1.00
38_R	66_H	2.773	1.00
85_G	88_G	2.532	1.00
17_A	33_V	2.445	1.00
33_V	74_A	2.254	1.00
45_V	54_Q	2.169	1.00
12_R	92_Q	2.160	1.00
16_Q	20_R	1.925	1.00
3_I	42_N	1.912	1.00
44_L	86_F	1.712	1.00
3_I	65_R	1.654	1.00
16_Q	83_E	1.650	1.00
93_T	97_C	1.561	1.00
46_D	87_T	1.544	1.00
34_G	71_I	1.502	1.00
4_P	8_D	1.468	1.00
29_E	77_L	1.430	1.00
12_R	84_V	1.399	1.00
39_V	86_F	1.383	1.00
11_R	15_I	1.382	1.00
9_C	80_Y	1.373	1.00
45_V	50_T	1.362	1.00
84_V	92_Q	1.336	1.00
88_G	92_Q	1.331	1.00
5_T	66_H	1.317	1.00
40_T	43_E	1.311	1.00
3_I	40_T	1.307	1.00
34_G	69_A	1.290	1.00
71_I	82_P	1.288	1.00
47_A	90_L	1.280	1.00
88_G	91_E	1.246	1.00
59_P	65_R	1.239	1.00
72_S	76_N	1.201	1.00
5_T	38_R	1.200	1.00
9_C	13_N	1.164	1.00
13_N	35_T	1.125	1.00
14_V	33_V	1.113	0.99
9_C	14_V	1.104	0.99
4_P	41_V	1.082	0.99
38_R	68_H	1.073	0.99
63_D	67_S	1.065	0.99
45_V	52_I	1.054	0.99
62_G	67_S	1.051	0.99
73_K	77_L	1.046	0.99
14_V	17_A	1.043	0.99
48_P	94_I	1.041	0.99
64_V	67_S	1.035	0.99
71_I	80_Y	1.005	0.99
69_A	80_Y	1.002	0.99
87_T	91_E	0.958	0.98
92_Q	95_P	0.949	0.98
20_R	23_E	0.944	0.98
60_R	64_V	0.916	0.98
10_T	92_Q	0.912	0.98
84_V	89_G	0.912	0.98
24_S	27_T	0.899	0.98
41_V	45_V	0.888	0.97
46_D	49_G	0.887	0.97
31_F	74_A	0.880	0.97
5_T	40_T	0.872	0.97
4_P	59_P	0.845	0.96
72_S	75_E	0.841	0.96
10_T	84_V	0.835	0.96
8_D	69_A	0.830	0.96
11_R	14_V	0.821	0.96
15_I	80_Y	0.810	0.96
26_V	29_E	0.808	0.95
20_R	79_G	0.808	0.95
13_N	86_F	0.808	0.95
43_E	87_T	0.806	0.95
21_A	78_L	0.801	0.95
39_V	44_L	0.791	0.95
18_N	22_A	0.790	0.95
37_G	68_H	0.786	0.95
35_T	85_G	0.782	0.95
91_E	95_P	0.777	0.94
60_R	67_S	0.775	0.94
19_I	23_E	0.774	0.94
21_A	74_A	0.766	0.94
74_A	78_L	0.749	0.93
6_H	63_D	0.738	0.93
37_G	85_G	0.738	0.93
10_T	93_T	0.735	0.93
55_I	58_D	0.729	0.92
13_N	80_Y	0.722	0.92
8_D	34_G	0.720	0.92
41_V	63_D	0.716	0.92
39_V	43_E	0.709	0.91
36_G	68_H	0.705	0.91
64_V	68_H	0.701	0.91
14_V	18_N	0.695	0.90
41_V	67_S	0.690	0.90
74_A	77_L	0.683	0.90
14_V	67_S	0.677	0.89
6_H	62_G	0.664	0.88
17_A	74_A	0.663	0.88
4_P	65_R	0.656	0.88
15_I	19_I	0.654	0.87
8_D	41_V	0.645	0.87
16_Q	80_Y	0.638	0.86
9_C	35_T	0.637	0.86
52_I	55_I	0.633	0.86
19_I	22_A	0.633	0.86
46_D	53_D	0.628	0.85
9_C	63_D	0.626	0.85
71_I	75_E	0.626	0.85
12_R	15_I	0.623	0.85
13_N	18_N	0.620	0.85
34_G	67_S	0.619	0.84
8_D	64_V	0.610	0.84
48_P	51_D	0.604	0.83
90_L	93_T	0.601	0.83
31_F	73_K	0.588	0.81
67_S	93_T	0.580	0.80
51_D	90_L	0.577	0.80
47_A	94_I	0.576	0.80
26_V	31_F	0.576	0.80
36_G	71_I	0.572	0.80
37_G	43_E	0.566	0.79
41_V	62_G	0.563	0.78
75_E	91_E	0.554	0.77
47_A	91_E	0.548	0.77
35_T	39_V	0.546	0.76
32_N	54_Q	0.534	0.75
38_R	69_A	0.533	0.75
5_T	39_V	0.533	0.75
8_D	38_R	0.531	0.74
35_T	93_T	0.527	0.74
31_F	78_L	0.525	0.74
47_A	50_T	0.522	0.73
17_A	45_V	0.521	0.73
18_N	45_V	0.521	0.73
9_C	59_P	0.521	0.73
37_G	87_T	0.520	0.73
67_S	96_Y	0.517	0.72
64_V	96_Y	0.515	0.72
5_T	67_S	0.510	0.71
25_D	28_G	0.505	0.71
53_D	83_E	0.504	0.71
44_L	56_Y	0.503	0.70
2_G	8_D	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2p5yA	1	0.9694	99.9	0.456	Contact Map
4lisA	2	1	99.9	0.462	Contact Map
1ek6A	2	1	99.9	0.47	Contact Map
1z45A	2	0.9082	99.9	0.471	Contact Map
1udbA	2	1	99.8	0.474	Contact Map
3enkA	2	1	99.8	0.478	Contact Map
1gy8A	2	1	99.8	0.492	Contact Map
3rufA	2	0.9592	99.8	0.496	Contact Map
1sb8A	2	1	99.8	0.498	Contact Map
2hunA	2	1	99.8	0.502	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.