Q9HSS6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSS6 - Putative heat shock protein

UniProt:	Q9HSS6	Sequences: MRRDDRDDPFDDIFREIERMMEDMMADGQRLDRGDQSGFASSTHVDVHETEDAIRVIADLPGVEKDDISIQCDGTSVTVSAQSGHREYDERVDLPGRVDAHSGAATYNNGILEVAFDRTESSTNIDVQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	128 (109)
Sequences:	4428 (3587)
Seq/√Len:	343.5

BACSU - COTP YOCM
HALSA - Q9HSS6 Q9HP50 Q9HHW1
SULSO - Q97W19 Q97VL9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
99_D	102_S	4.259	1.00
53_A	115_A	3.132	1.00
50_T	53_A	2.857	1.00
58_A	79_V	2.713	1.00
64_E	109_N	2.656	1.00
45_V	58_A	2.331	1.00
49_E	118_R	2.269	1.00
59_D	111_I	2.167	1.00
45_V	92_V	2.159	1.00
98_V	116_F	2.098	1.00
50_T	55_R	2.087	1.00
64_E	67_D	2.012	1.00
68_I	107_Y	1.996	1.00
60_L	107_Y	1.925	1.00
69_S	80_S	1.881	1.00
80_S	89_D	1.846	1.00
57_I	113_E	1.774	1.00
60_L	68_I	1.732	1.00
76_S	91_R	1.687	1.00
120_E	123_T	1.684	1.00
55_R	113_E	1.672	1.00
99_D	119_T	1.649	1.00
72_C	94_L	1.634	1.00
48_H	55_R	1.628	1.00
76_S	93_D	1.551	1.00
102_S	117_D	1.549	1.00
43_T	88_Y	1.520	1.00
63_V	81_A	1.489	1.00
81_A	88_Y	1.488	1.00
64_E	108_N	1.433	1.00
23_D	26_A	1.343	1.00
46_D	57_I	1.295	1.00
78_T	91_R	1.277	1.00
22_E	25_M	1.248	1.00
72_C	103_G	1.230	1.00
77_V	114_V	1.224	1.00
77_V	103_G	1.215	1.00
65_K	109_N	1.202	1.00
19_R	23_D	1.197	1.00
56_V	116_F	1.190	1.00
16_E	21_M	1.190	1.00
46_D	59_D	1.172	1.00
48_H	57_I	1.157	1.00
106_T	113_E	1.118	1.00
67_D	84_G	1.117	1.00
71_Q	78_T	1.115	1.00
65_K	69_S	1.084	1.00
70_I	114_V	1.082	1.00
18_E	21_M	1.055	1.00
100_A	117_D	1.054	1.00
97_R	119_T	1.052	1.00
94_L	116_F	1.034	1.00
16_E	20_M	1.017	1.00
45_V	79_V	1.015	1.00
106_T	115_A	1.015	1.00
75_T	100_A	1.000	1.00
21_M	25_M	0.999	1.00
41_S	81_A	0.990	1.00
17_I	21_M	0.988	1.00
55_R	115_A	0.961	1.00
54_I	96_G	0.939	1.00
47_V	56_V	0.927	1.00
22_E	26_A	0.922	1.00
60_L	81_A	0.918	1.00
67_D	83_S	0.917	1.00
48_H	54_I	0.916	1.00
19_R	24_M	0.902	1.00
47_V	54_I	0.901	1.00
52_D	123_T	0.886	1.00
54_I	97_R	0.883	1.00
60_L	88_Y	0.883	1.00
16_E	19_R	0.871	1.00
30_R	33_R	0.857	1.00
57_I	86_R	0.848	1.00
63_V	83_S	0.840	1.00
43_T	58_A	0.839	1.00
108_N	113_E	0.823	1.00
97_R	118_R	0.819	1.00
54_I	118_R	0.815	1.00
16_E	23_D	0.812	1.00
56_V	92_V	0.810	1.00
60_L	63_V	0.795	1.00
96_G	119_T	0.781	1.00
54_I	103_G	0.778	1.00
75_T	96_G	0.767	1.00
23_D	27_D	0.760	1.00
95_P	98_V	0.755	1.00
59_D	83_S	0.754	1.00
28_G	31_L	0.752	1.00
70_I	105_A	0.745	1.00
49_E	65_K	0.743	1.00
18_E	23_D	0.735	0.99
19_R	22_E	0.729	0.99
43_T	60_L	0.725	0.99
46_D	60_L	0.724	0.99
22_E	27_D	0.724	0.99
18_E	22_E	0.716	0.99
36_Q	40_A	0.716	0.99
25_M	28_G	0.714	0.99
42_S	46_D	0.705	0.99
21_M	24_M	0.694	0.99
72_C	100_A	0.693	0.99
81_A	95_P	0.688	0.99
83_S	90_E	0.688	0.99
57_I	111_I	0.684	0.99
78_T	89_D	0.680	0.99
28_G	32_D	0.662	0.99
69_S	82_Q	0.661	0.99
43_T	95_P	0.647	0.99
53_A	118_R	0.646	0.99
68_I	114_V	0.644	0.99
43_T	81_A	0.639	0.99
20_M	27_D	0.638	0.99
24_M	27_D	0.628	0.98
18_E	26_A	0.628	0.98
64_E	107_Y	0.627	0.98
71_Q	80_S	0.626	0.98
31_L	34_G	0.626	0.98
63_V	68_I	0.625	0.98
96_G	103_G	0.621	0.98
43_T	46_D	0.612	0.98
20_M	24_M	0.608	0.98
74_G	97_R	0.607	0.98
121_S	124_N	0.600	0.98
21_M	26_A	0.597	0.98
19_R	26_A	0.593	0.98
32_D	35_D	0.590	0.98
38_G	41_S	0.587	0.97
104_A	115_A	0.586	0.97
35_D	39_F	0.582	0.97
17_I	23_D	0.576	0.97
20_M	23_D	0.566	0.97
18_E	25_M	0.565	0.97
44_H	78_T	0.561	0.97
86_R	90_E	0.557	0.97
77_V	124_N	0.557	0.97
65_K	107_Y	0.555	0.96
34_G	38_G	0.552	0.96
31_L	35_D	0.551	0.96
27_D	30_R	0.549	0.96
44_H	59_D	0.549	0.96
46_D	93_D	0.539	0.96
54_I	98_V	0.533	0.96
97_R	122_S	0.532	0.96
24_M	28_G	0.532	0.96
82_Q	86_R	0.531	0.95
49_E	53_A	0.529	0.95
72_C	77_V	0.526	0.95
41_S	46_D	0.521	0.95
99_D	120_E	0.521	0.95
37_S	85_H	0.520	0.95
75_T	97_R	0.519	0.95
77_V	116_F	0.516	0.95
17_I	20_M	0.513	0.95
45_V	72_C	0.511	0.94
28_G	37_S	0.511	0.94
119_T	122_S	0.510	0.94
65_K	68_I	0.508	0.94
75_T	93_D	0.507	0.94
45_V	94_L	0.506	0.94
59_D	68_I	0.506	0.94
32_D	37_S	0.502	0.94
37_S	41_S	0.502	0.94
71_Q	92_V	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4eldA	4	0.7578	100	0.237	Contact Map
3w1zA	7	0.9375	100	0.269	Contact Map
3aabA	2	0.7734	99.9	0.308	Contact Map
1gmeA	6	0.9766	99.9	0.322	Contact Map
2bolA	2	0.9922	99.9	0.329	Contact Map
4ydzA	4	0.8438	99.9	0.349	Contact Map
2klrA	2	0.5625	99.9	0.357	Contact Map
4jutA	4	0.625	99.9	0.372	Contact Map
3glaA	2	0.6562	99.9	0.374	Contact Map
3l1eA	2	0.6797	99.9	0.38	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.