RL10E - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL10E - 50S ribosomal protein L10e

UniProt:	Q9HSS4	Sequences: MSEKPASMYRKIDKPSYTRRDYVTGIPGSKIAQHKMGDLQADADDYPVQISLVPQEECQLRHGSLEAARLSANRHLIKELGEGNYKMQLRKFPHQIIRENKQATGAGADRVSDGMRQAFGVPVGTAARIQPGDQLFTAYCEVEQAAAVKEAFRRAYNKITPPCKINVERGETLLVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	176 (167)
Sequences:	338 (175)
Seq/√Len:	13.6

HALSA - RL10E
SULSO - RL10E

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
76_L	138_A	3.960	1.00
91_K	133_D	3.885	1.00
4_K	8_M	3.195	0.98
75_H	154_R	3.049	0.97
17_Y	119_F	2.954	0.97
140_C	148_V	2.788	0.95
80_L	84_N	2.627	0.94
76_L	80_L	2.531	0.92
72_A	155_A	2.391	0.90
89_L	136_F	2.296	0.88
35_K	88_Q	2.288	0.88
16_S	95_Q	2.093	0.82
146_A	165_I	2.090	0.82
88_Q	153_R	2.072	0.82
102_Q	111_V	1.998	0.79
145_A	148_V	1.983	0.79
97_I	126_A	1.982	0.79
100_N	111_V	1.982	0.79
22_Y	113_D	1.969	0.78
62_H	125_T	1.968	0.78
55_Q	164_K	1.950	0.78
1_M	5_P	1.910	0.76
150_E	154_R	1.906	0.76
140_C	144_Q	1.859	0.74
145_A	170_G	1.784	0.71
76_L	96_I	1.767	0.70
35_K	86_K	1.758	0.70
100_N	112_S	1.683	0.66
76_L	148_V	1.649	0.64
4_K	118_A	1.646	0.64
152_F	160_T	1.637	0.64
150_E	153_R	1.632	0.64
80_L	87_M	1.629	0.63
87_M	136_F	1.612	0.63
77_I	85_Y	1.586	0.61
34_H	146_A	1.565	0.60
148_V	160_T	1.559	0.60
4_K	123_V	1.538	0.59
76_L	140_C	1.536	0.59
74_R	111_V	1.531	0.58
31_I	34_H	1.525	0.58
129_I	133_D	1.513	0.58
16_S	49_Q	1.509	0.57
118_A	125_T	1.460	0.55
103_A	112_S	1.456	0.55
103_A	111_V	1.431	0.53
39_L	88_Q	1.422	0.53
98_R	116_R	1.394	0.51
69_R	116_R	1.361	0.49
75_H	150_E	1.353	0.49
25_G	56_E	1.288	0.46
50_I	148_V	1.275	0.45
107_G	110_R	1.269	0.45
8_M	112_S	1.253	0.44
60_L	145_A	1.237	0.43
89_L	167_V	1.233	0.43
4_K	24_T	1.233	0.43
69_R	98_R	1.201	0.41
80_L	147_A	1.191	0.41
48_V	60_L	1.187	0.40
23_V	96_I	1.172	0.40
73_N	129_I	1.151	0.38
138_A	148_V	1.149	0.38
136_F	146_A	1.137	0.38
64_S	67_A	1.135	0.38
3_E	10_R	1.124	0.37
8_M	103_A	1.110	0.36
11_K	15_P	1.105	0.36
11_K	14_K	1.078	0.35
54_P	161_P	1.060	0.34
67_A	124_G	1.057	0.34
87_M	148_V	1.055	0.34
105_G	111_V	1.045	0.33
72_A	148_V	1.044	0.33
72_A	140_C	1.043	0.33
56_E	131_P	1.041	0.33
33_Q	103_A	1.032	0.33
24_T	58_C	1.015	0.32
25_G	155_A	1.001	0.31
13_D	30_K	1.001	0.31
26_I	125_T	1.000	0.31
105_G	112_S	0.997	0.31
16_S	39_L	0.991	0.31
7_S	102_Q	0.984	0.30
3_E	15_P	0.980	0.30
17_Y	23_V	0.979	0.30
4_K	7_S	0.973	0.30
19_R	23_V	0.968	0.30
56_E	78_K	0.951	0.29
32_A	122_P	0.947	0.29
52_L	60_L	0.946	0.29
94_H	165_I	0.940	0.28
52_L	98_R	0.937	0.28
7_S	100_N	0.935	0.28
65_L	91_K	0.933	0.28
12_I	57_E	0.931	0.28
5_P	9_Y	0.925	0.28
52_L	151_A	0.916	0.27
45_D	84_N	0.915	0.27
54_P	57_E	0.910	0.27
94_H	149_K	0.898	0.27
35_K	46_Y	0.898	0.27
73_N	127_A	0.884	0.26
53_V	67_A	0.881	0.26
57_E	71_S	0.881	0.26
45_D	89_L	0.872	0.26
68_A	159_I	0.872	0.26
51_S	54_P	0.865	0.25
8_M	104_T	0.858	0.25
85_Y	134_Q	0.856	0.25
6_A	118_A	0.834	0.24
8_M	102_Q	0.833	0.24
58_C	112_S	0.826	0.24
32_A	39_L	0.825	0.24
29_S	125_T	0.824	0.24
142_V	169_R	0.818	0.23
102_Q	112_S	0.812	0.23
111_V	122_P	0.810	0.23
71_S	74_R	0.805	0.23
36_M	165_I	0.802	0.23
75_H	95_Q	0.792	0.23
96_I	170_G	0.791	0.22
6_A	90_R	0.791	0.22
59_Q	66_E	0.782	0.22
79_E	130_Q	0.774	0.22
100_N	116_R	0.773	0.22
72_A	138_A	0.773	0.22
64_S	96_I	0.771	0.22
60_L	136_F	0.764	0.21
149_K	169_R	0.764	0.21
50_I	167_V	0.764	0.21
65_L	68_A	0.762	0.21
30_K	50_I	0.754	0.21
15_P	95_Q	0.748	0.21
69_R	120_G	0.744	0.21
4_K	162_P	0.742	0.21
95_Q	125_T	0.740	0.21
36_M	126_A	0.736	0.20
26_I	29_S	0.734	0.20
94_H	103_A	0.733	0.20
140_C	160_T	0.732	0.20
90_R	116_R	0.730	0.20
35_K	163_C	0.727	0.20
59_Q	128_R	0.725	0.20
122_P	154_R	0.723	0.20
136_F	147_A	0.722	0.20
130_Q	150_E	0.720	0.20
47_P	86_K	0.719	0.20
36_M	60_L	0.718	0.20
94_H	167_V	0.717	0.20
99_E	123_V	0.714	0.20
102_Q	156_Y	0.713	0.20
55_Q	159_I	0.710	0.20
36_M	143_E	0.700	0.19
58_C	102_Q	0.699	0.19
98_R	109_D	0.696	0.19
73_N	85_Y	0.696	0.19
58_C	161_P	0.693	0.19
31_I	89_L	0.691	0.19
67_A	139_Y	0.691	0.19
71_S	77_I	0.687	0.19
90_R	162_P	0.685	0.19
8_M	63_G	0.683	0.19
36_M	48_V	0.682	0.19
60_L	71_S	0.679	0.19
50_I	97_I	0.678	0.19
72_A	87_M	0.678	0.19
14_K	128_R	0.678	0.19
100_N	103_A	0.671	0.18
67_A	95_Q	0.670	0.18
61_R	126_A	0.670	0.18
94_H	148_V	0.667	0.18
151_A	160_T	0.659	0.18
149_K	159_I	0.655	0.18
97_I	130_Q	0.652	0.18
51_S	90_R	0.651	0.18
9_Y	100_N	0.649	0.18
97_I	145_A	0.645	0.17
24_T	154_R	0.641	0.17
15_P	62_H	0.635	0.17
86_K	139_Y	0.631	0.17
4_K	161_P	0.631	0.17
96_I	130_Q	0.630	0.17
70_L	73_N	0.629	0.17
89_L	163_C	0.627	0.17
3_E	11_K	0.627	0.17
106_A	110_R	0.621	0.17
2_S	104_T	0.613	0.17
65_L	76_L	0.607	0.16
98_R	108_A	0.599	0.16
69_R	106_A	0.597	0.16
23_V	58_C	0.595	0.16
134_Q	151_A	0.592	0.16
8_M	33_Q	0.589	0.16
6_A	154_R	0.589	0.16
13_D	16_S	0.589	0.16
5_P	114_G	0.588	0.16
59_Q	126_A	0.578	0.16
78_K	96_I	0.574	0.15
32_A	162_P	0.573	0.15
31_I	132_G	0.571	0.15
23_V	119_F	0.571	0.15
143_E	163_C	0.570	0.15
13_D	122_P	0.567	0.15
80_L	138_A	0.566	0.15
3_E	63_G	0.565	0.15
30_K	62_H	0.563	0.15
81_G	153_R	0.560	0.15
85_Y	142_V	0.559	0.15
91_K	97_I	0.559	0.15
98_R	120_G	0.556	0.15
13_D	95_Q	0.555	0.15
46_Y	87_M	0.555	0.15
106_A	109_D	0.555	0.15
86_K	159_I	0.554	0.15
48_V	145_A	0.553	0.15
6_A	83_G	0.549	0.15
3_E	8_M	0.548	0.15
8_M	111_V	0.548	0.15
88_Q	129_I	0.545	0.15
80_L	144_Q	0.545	0.15
140_C	153_R	0.543	0.15
41_A	85_Y	0.542	0.15
6_A	117_Q	0.541	0.15
109_D	114_G	0.540	0.14
126_A	136_F	0.539	0.14
113_D	126_A	0.538	0.14
20_R	23_V	0.537	0.14
122_P	139_Y	0.537	0.14
31_I	167_V	0.537	0.14
29_S	89_L	0.536	0.14
93_P	106_A	0.534	0.14
148_V	165_I	0.533	0.14
99_E	105_G	0.533	0.14
68_A	72_A	0.532	0.14
4_K	98_R	0.531	0.14
15_P	19_R	0.523	0.14
131_P	138_A	0.521	0.14
22_Y	138_A	0.521	0.14
63_G	157_N	0.519	0.14
7_S	122_P	0.519	0.14
51_S	134_Q	0.515	0.14
26_I	121_V	0.514	0.14
138_A	154_R	0.513	0.14
18_T	49_Q	0.508	0.14
60_L	135_L	0.507	0.14
29_S	32_A	0.506	0.14
68_A	160_T	0.505	0.14
8_M	24_T	0.502	0.14
56_E	67_A	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4a17H	1	0.9318	100	0.252	Contact Map
3j39I	1	0.9943	100	0.252	Contact Map
3zf7K	1	0.9943	100	0.254	Contact Map
1vx7Q	1	0.9034	100	0.258	Contact Map
4ujqL	1	0.9432	100	0.265	Contact Map
3j21N	1	0.9432	100	0.269	Contact Map
1vq8H	1	0.9034	100	0.29	Contact Map
1ffkF	1	0.892	100	0.383	Contact Map
2pa2A	1	0.6136	100	0.445	Contact Map
3j7yN	1	0.8352	100	0.54	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.