Q9HSP1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSP1 - Uncharacterized protein

UniProt:	Q9HSP1	Sequences: MPDSMAEQLRHDMTCDGLLECFHGLKQLDKGVFQALVTTNDALTVDDIAERVDRERSTAYRAVQRLLSAGLIQKEQINYDQGGYYHVYEPTDPAEIADDMQRLLNDWYAKMGQLIQEFETKYDRTDAGVQSIEG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	134 (113)
Sequences:	170 (113)
Seq/√Len:	10.6

HALSA - Q9HSP1 O54663

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_K	92_D	3.035	0.94
12_D	53_D	3.022	0.94
63_V	76_Q	2.844	0.92
33_F	71_L	2.675	0.89
48_I	52_V	2.600	0.88
16_D	73_Q	2.254	0.79
26_K	59_A	2.254	0.79
19_L	45_V	2.201	0.77
29_D	85_Y	2.140	0.75
22_F	39_T	1.994	0.69
14_T	18_L	1.983	0.69
39_T	95_E	1.983	0.69
12_D	68_S	1.978	0.69
63_V	78_N	1.793	0.61
48_I	97_A	1.718	0.57
24_G	93_P	1.707	0.57
16_D	102_R	1.696	0.56
50_E	98_D	1.668	0.55
12_D	42_A	1.598	0.52
62_A	84_Y	1.580	0.51
108_Y	114_L	1.550	0.49
22_F	77_I	1.548	0.49
19_L	46_D	1.545	0.49
102_R	121_K	1.525	0.48
22_F	69_A	1.477	0.46
100_M	103_L	1.371	0.41
40_N	70_G	1.361	0.41
45_V	119_E	1.347	0.40
116_Q	120_T	1.318	0.39
36_L	45_V	1.317	0.39
15_C	86_H	1.289	0.37
19_L	70_G	1.286	0.37
29_D	62_A	1.267	0.36
55_E	85_Y	1.263	0.36
56_R	61_R	1.255	0.36
8_Q	88_Y	1.232	0.35
53_D	59_A	1.232	0.35
72_I	121_K	1.230	0.35
61_R	78_N	1.224	0.35
15_C	60_Y	1.221	0.34
72_I	75_E	1.219	0.34
104_L	117_E	1.195	0.33
72_I	96_I	1.188	0.33
36_L	72_I	1.185	0.33
39_T	44_T	1.180	0.33
49_A	59_A	1.180	0.33
28_L	93_P	1.180	0.33
36_L	104_L	1.178	0.33
13_M	68_S	1.177	0.33
87_V	105_N	1.129	0.31
48_I	77_I	1.115	0.30
17_G	73_Q	1.063	0.28
50_E	67_L	1.055	0.28
98_D	119_E	1.040	0.27
57_S	76_Q	1.027	0.27
29_D	41_D	1.027	0.27
18_L	34_Q	1.027	0.27
36_L	63_V	1.026	0.27
27_Q	100_M	1.006	0.26
84_Y	97_A	1.004	0.26
53_D	102_R	1.004	0.26
64_Q	67_L	0.988	0.25
8_Q	119_E	0.986	0.25
24_G	111_M	0.984	0.25
50_E	81_Q	0.980	0.25
64_Q	68_S	0.978	0.25
20_E	23_H	0.971	0.25
43_L	115_I	0.965	0.24
74_K	96_I	0.957	0.24
102_R	109_A	0.955	0.24
16_D	121_K	0.943	0.24
100_M	115_I	0.943	0.24
67_L	70_G	0.942	0.24
47_D	67_L	0.939	0.24
73_Q	92_D	0.937	0.23
90_P	104_L	0.930	0.23
70_G	91_T	0.923	0.23
59_A	121_K	0.923	0.23
85_Y	106_D	0.912	0.23
29_D	49_A	0.892	0.22
43_L	87_V	0.881	0.22
91_T	115_I	0.879	0.22
13_M	77_I	0.876	0.21
29_D	65_R	0.876	0.21
55_E	107_W	0.864	0.21
59_A	103_L	0.862	0.21
41_D	47_D	0.847	0.21
92_D	103_L	0.839	0.20
51_R	75_E	0.828	0.20
16_D	30_K	0.825	0.20
35_A	51_R	0.825	0.20
63_V	80_D	0.819	0.20
98_D	106_D	0.813	0.20
24_G	91_T	0.805	0.19
88_Y	116_Q	0.797	0.19
65_R	74_K	0.784	0.19
100_M	114_L	0.764	0.18
80_D	101_Q	0.763	0.18
9_L	106_D	0.758	0.18
53_D	90_P	0.755	0.18
104_L	118_F	0.754	0.18
11_H	72_I	0.754	0.18
33_F	92_D	0.751	0.18
48_I	61_R	0.744	0.18
20_E	30_K	0.743	0.18
55_E	79_Y	0.741	0.17
11_H	16_D	0.741	0.17
101_Q	112_G	0.737	0.17
41_D	50_E	0.734	0.17
20_E	46_D	0.730	0.17
44_T	85_Y	0.729	0.17
54_R	120_T	0.726	0.17
27_Q	53_D	0.699	0.16
53_D	92_D	0.691	0.16
21_C	111_M	0.689	0.16
101_Q	115_I	0.687	0.16
58_T	96_I	0.686	0.16
37_V	109_A	0.684	0.16
32_V	52_V	0.676	0.16
24_G	52_V	0.666	0.16
53_D	120_T	0.665	0.16
24_G	54_R	0.660	0.15
52_V	74_K	0.653	0.15
15_C	85_Y	0.652	0.15
11_H	89_E	0.650	0.15
32_V	74_K	0.648	0.15
71_L	89_E	0.643	0.15
89_E	116_Q	0.638	0.15
31_G	35_A	0.637	0.15
41_D	77_I	0.621	0.14
35_A	48_I	0.613	0.14
9_L	12_D	0.595	0.14
94_A	119_E	0.591	0.14
41_D	71_L	0.583	0.14
23_H	61_R	0.582	0.14
31_G	43_L	0.576	0.13
51_R	92_D	0.574	0.13
94_A	115_I	0.569	0.13
27_Q	121_K	0.568	0.13
57_S	82_G	0.564	0.13
24_G	33_F	0.563	0.13
58_T	84_Y	0.563	0.13
9_L	114_L	0.561	0.13
51_R	68_S	0.560	0.13
27_Q	90_P	0.557	0.13
40_N	71_L	0.556	0.13
15_C	42_A	0.556	0.13
27_Q	63_V	0.555	0.13
45_V	69_A	0.552	0.13
75_E	89_E	0.551	0.13
65_R	101_Q	0.546	0.13
14_T	34_Q	0.541	0.13
32_V	100_M	0.538	0.13
88_Y	119_E	0.534	0.13
42_A	59_A	0.533	0.13
57_S	61_R	0.532	0.12
10_R	97_A	0.531	0.12
31_G	92_D	0.531	0.12
84_Y	103_L	0.531	0.12
100_M	106_D	0.529	0.12
87_V	94_A	0.525	0.12
26_K	58_T	0.523	0.12
64_Q	85_Y	0.519	0.12
68_S	121_K	0.519	0.12
57_S	78_N	0.518	0.12
13_M	23_H	0.516	0.12
61_R	82_G	0.509	0.12
85_Y	111_M	0.509	0.12
93_P	97_A	0.504	0.12
69_A	80_D	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3r0aA	2	0.903	99.6	0.666	Contact Map
3qphA	2	0.8134	99.4	0.708	Contact Map
1sfxA	3	0.8134	99	0.757	Contact Map
1q1hA	1	0.6269	99	0.757	Contact Map
2d1hA	2	0.7537	98.9	0.764	Contact Map
1okrA	2	0.8284	98.8	0.772	Contact Map
2g9wA	2	0.6791	98.6	0.784	Contact Map
4nb5A	4	0.9328	98.6	0.785	Contact Map
2oqgA	4	0.8134	98.6	0.786	Contact Map
3cuoA	2	0.7313	98.6	0.788	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.