Q9HSN9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSN9 - Uncharacterized protein

UniProt:	Q9HSN9	Sequences: MLPIDPAAIDPADIGEQQATLELSHEDAIEHVRDVFTDAGFGVPVEFSPAELLNEKIDADRDPYYVLGACHPDVADRALDATDNRLGALMPCNVVIWAESPGRQRVYHVSIMRIARLLGMAADDSEMQDIVATTGEMVDEAFDRL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (122)
Sequences:	767 (560)
Seq/√Len:	50.7

HALSA - Q9HSN9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_S	27_D	3.650	1.00
39_A	140_E	3.193	1.00
52_L	55_E	3.054	1.00
23_L	28_A	3.048	1.00
46_E	65_Y	3.019	1.00
33_R	46_E	2.993	1.00
64_Y	87_G	2.553	1.00
50_A	63_P	2.502	1.00
29_I	96_I	2.418	1.00
63_P	98_A	2.324	1.00
39_A	137_M	2.316	1.00
82_T	124_D	2.206	1.00
86_L	122_A	2.198	1.00
35_V	38_D	2.152	1.00
113_R	135_G	2.146	1.00
49_P	79_L	2.133	1.00
48_S	51_E	2.108	1.00
117_L	134_T	1.982	1.00
16_E	88_A	1.922	0.99
49_P	66_V	1.831	0.99
33_R	37_T	1.745	0.99
23_L	31_H	1.728	0.99
133_T	137_M	1.695	0.98
21_L	28_A	1.694	0.98
111_I	142_F	1.693	0.98
42_G	56_K	1.666	0.98
30_E	34_D	1.662	0.98
29_I	65_Y	1.593	0.98
62_D	84_N	1.584	0.98
54_N	60_D	1.565	0.97
78_A	86_L	1.547	0.97
34_D	38_D	1.537	0.97
77_R	133_T	1.470	0.96
76_D	80_D	1.355	0.94
28_A	109_V	1.296	0.93
99_E	108_H	1.244	0.91
42_G	72_P	1.240	0.91
51_E	55_E	1.216	0.90
74_V	134_T	1.213	0.90
115_A	132_A	1.187	0.89
89_L	118_L	1.187	0.89
135_G	139_D	1.151	0.87
29_I	33_R	1.105	0.85
45_V	52_L	1.102	0.85
35_V	141_A	1.068	0.83
98_A	102_G	1.063	0.83
25_H	96_I	1.062	0.83
81_A	126_E	1.028	0.81
53_L	57_I	1.025	0.80
36_F	138_V	1.024	0.80
117_L	120_M	0.992	0.78
84_N	97_W	0.988	0.78
128_Q	132_A	0.983	0.78
27_D	30_E	0.974	0.77
18_Q	110_S	0.959	0.76
112_M	117_L	0.952	0.75
17_Q	20_T	0.951	0.75
118_L	134_T	0.945	0.75
59_A	80_D	0.931	0.74
90_M	114_I	0.931	0.74
115_A	135_G	0.930	0.74
54_N	58_D	0.919	0.73
89_L	120_M	0.910	0.72
89_L	112_M	0.909	0.72
62_D	97_W	0.903	0.71
53_L	61_R	0.898	0.71
57_I	61_R	0.885	0.70
25_H	65_Y	0.883	0.70
36_F	67_L	0.882	0.70
61_R	97_W	0.881	0.69
34_D	37_T	0.877	0.69
126_E	129_D	0.872	0.69
70_C	75_A	0.852	0.67
39_A	141_A	0.852	0.67
45_V	68_G	0.848	0.66
62_D	98_A	0.845	0.66
137_M	140_E	0.841	0.66
73_D	77_R	0.833	0.65
56_K	75_A	0.823	0.64
74_V	137_M	0.822	0.64
27_D	31_H	0.821	0.64
68_G	93_N	0.817	0.64
129_D	133_T	0.814	0.63
119_G	123_D	0.809	0.63
48_S	65_Y	0.804	0.62
47_F	52_L	0.799	0.62
59_A	76_D	0.793	0.61
90_M	138_V	0.790	0.61
64_Y	71_H	0.774	0.59
53_L	63_P	0.766	0.59
115_A	139_D	0.765	0.58
22_E	101_P	0.761	0.58
70_C	92_C	0.752	0.57
55_E	122_A	0.751	0.57
69_A	95_V	0.742	0.56
139_D	143_D	0.738	0.56
40_G	58_D	0.733	0.55
129_D	132_A	0.730	0.55
24_S	54_N	0.728	0.55
114_I	131_V	0.724	0.54
36_F	141_A	0.724	0.54
41_F	78_A	0.722	0.54
102_G	135_G	0.722	0.54
47_F	68_G	0.719	0.54
89_L	93_N	0.717	0.54
125_S	129_D	0.717	0.54
86_L	124_D	0.716	0.54
60_D	131_V	0.713	0.53
19_A	23_L	0.710	0.53
55_E	58_D	0.708	0.53
116_R	120_M	0.701	0.52
16_E	110_S	0.698	0.52
79_L	95_V	0.689	0.51
45_V	93_N	0.689	0.51
115_A	128_Q	0.685	0.50
40_G	86_L	0.683	0.50
85_R	108_H	0.677	0.49
22_E	27_D	0.673	0.49
69_A	93_N	0.671	0.49
56_K	70_C	0.670	0.49
100_S	103_R	0.665	0.48
19_A	31_H	0.664	0.48
60_D	109_V	0.654	0.47
22_E	28_A	0.649	0.47
52_L	56_K	0.645	0.46
117_L	127_M	0.643	0.46
24_S	63_P	0.639	0.46
26_E	65_Y	0.635	0.45
47_F	94_V	0.633	0.45
41_F	44_P	0.628	0.44
31_H	73_D	0.622	0.44
47_F	93_N	0.617	0.43
32_V	35_V	0.615	0.43
73_D	100_S	0.613	0.43
56_K	92_C	0.610	0.43
23_L	27_D	0.608	0.42
112_M	116_R	0.607	0.42
39_A	134_T	0.605	0.42
36_F	90_M	0.604	0.42
43_V	134_T	0.601	0.42
77_R	81_A	0.599	0.42
42_G	47_F	0.598	0.41
75_A	90_M	0.591	0.41
88_A	110_S	0.588	0.40
16_E	85_R	0.586	0.40
27_D	34_D	0.578	0.39
36_F	94_V	0.573	0.39
66_V	77_R	0.565	0.38
86_L	118_L	0.564	0.38
78_A	127_M	0.560	0.38
57_I	82_T	0.559	0.38
85_R	110_S	0.559	0.38
113_R	116_R	0.557	0.37
25_H	63_P	0.556	0.37
19_A	110_S	0.555	0.37
58_D	68_G	0.555	0.37
26_E	63_P	0.554	0.37
20_T	24_S	0.553	0.37
127_M	130_I	0.553	0.37
69_A	94_V	0.553	0.37
36_F	87_G	0.551	0.37
87_G	138_V	0.547	0.36
100_S	119_G	0.545	0.36
36_F	93_N	0.544	0.36
116_R	125_S	0.544	0.36
108_H	118_L	0.542	0.36
74_V	77_R	0.542	0.36
47_F	66_V	0.541	0.36
42_G	68_G	0.536	0.35
80_D	133_T	0.534	0.35
41_F	134_T	0.528	0.35
25_H	32_V	0.527	0.35
82_T	113_R	0.526	0.34
66_V	94_V	0.523	0.34
44_P	71_H	0.522	0.34
31_H	85_R	0.519	0.34
26_E	140_E	0.515	0.33
66_V	93_N	0.510	0.33
137_M	141_A	0.506	0.33
26_E	30_E	0.503	0.32
81_A	128_Q	0.501	0.32
97_W	108_H	0.501	0.32
53_L	76_D	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1j3mA	2	0.8552	100	0.376	Contact Map
1q9uA	2	0.869	100	0.388	Contact Map
4ozjA	3	0.7034	51.6	0.925	Contact Map
4r25A	3	0.7103	42.3	0.929	Contact Map
3bzqA	3	0.6759	41.1	0.93	Contact Map
2eg2A	5	0.6414	38.9	0.931	Contact Map
1hwuA	6	0.6621	36.1	0.932	Contact Map
4co3A	3	0.6621	33.7	0.933	Contact Map
2ns1B	3	0.7034	31.5	0.934	Contact Map
2o66A	5	0.6897	30.9	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.