NUCS1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NUCS1 - Endonuclease NucS 1

UniProt:	Q9HSL7	Sequences: MPRTLTDPTADRAAAFATDAAADGLTVSLIGSCVATLTGRSQRDLAAGVRTLLWKPDDTVVVHGASGRDPDAWASGGPVTVDAADGLTVACDGGHTAGALRVRFDAVHTATAFDAAGADATTVSGTEAALKDRVLDTPDLVEPGFQPLATERDTPAGPIDIYGRDADGTVTAVELKNVRAGPAAASQLQRYVAALRRTLHADATVRGILVAPAVTAKTRRLLADRGLTFSPVSPPGSRDR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	240 (208)
Sequences:	459 (183)
Seq/√Len:	12.7

HALSA - NUCS1 NUCS2
SULSO - NUCS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
138_P	161_I	5.921	1.00
206_R	228_T	5.343	1.00
192_V	227_L	4.640	1.00
61_V	67_G	4.527	1.00
138_P	163_G	3.637	0.99
60_V	102_V	3.533	0.99
61_V	66_S	3.229	0.98
94_G	98_G	2.775	0.94
47_A	105_D	2.734	0.94
129_A	132_D	2.720	0.94
29_L	52_L	2.655	0.93
36_T	44_D	2.633	0.92
32_S	49_V	2.563	0.91
141_V	173_V	2.474	0.90
137_T	140_L	2.384	0.88
140_L	145_F	2.257	0.85
61_V	64_G	2.250	0.85
165_D	206_R	2.201	0.83
138_P	145_F	2.195	0.83
185_A	218_T	2.136	0.81
162_Y	170_V	2.128	0.81
52_L	62_V	2.114	0.81
138_P	232_V	2.106	0.80
208_I	228_T	2.076	0.79
141_V	232_V	2.033	0.78
153_D	195_L	1.918	0.74
98_G	103_R	1.906	0.73
75_S	117_G	1.865	0.71
181_G	215_T	1.787	0.68
138_P	175_L	1.769	0.67
93_G	96_T	1.743	0.66
173_V	208_I	1.722	0.65
223_A	228_T	1.715	0.65
49_V	108_H	1.674	0.63
141_V	145_F	1.663	0.62
145_F	163_G	1.652	0.62
142_E	145_F	1.646	0.61
145_F	161_I	1.645	0.61
31_G	104_F	1.638	0.61
32_S	105_D	1.616	0.60
28_S	51_T	1.612	0.60
64_G	67_G	1.562	0.57
53_L	66_S	1.534	0.56
109_T	113_F	1.526	0.55
161_I	232_V	1.438	0.51
142_E	206_R	1.432	0.51
52_L	102_V	1.413	0.50
89_V	93_G	1.386	0.48
92_D	97_A	1.372	0.47
178_V	213_A	1.363	0.47
75_S	96_T	1.363	0.47
89_V	98_G	1.357	0.47
65_A	178_V	1.356	0.47
144_G	165_D	1.338	0.46
89_V	92_D	1.334	0.46
98_G	137_T	1.298	0.44
98_G	105_D	1.285	0.43
129_A	181_G	1.279	0.43
33_C	45_L	1.278	0.43
43_R	74_A	1.274	0.42
163_G	175_L	1.266	0.42
89_V	96_T	1.263	0.42
86_G	101_R	1.245	0.41
196_R	205_V	1.244	0.41
45_L	121_T	1.235	0.41
161_I	175_L	1.231	0.40
208_I	215_T	1.226	0.40
94_G	102_V	1.207	0.39
141_V	228_T	1.204	0.39
197_R	224_D	1.196	0.39
89_V	101_R	1.187	0.38
125_G	190_R	1.170	0.37
139_D	143_P	1.169	0.37
143_P	166_A	1.163	0.37
93_G	98_G	1.162	0.37
106_A	139_D	1.123	0.35
195_L	232_V	1.111	0.35
52_L	95_H	1.100	0.34
128_A	131_K	1.094	0.34
93_G	169_T	1.077	0.33
59_T	210_V	1.070	0.33
153_D	162_Y	1.056	0.32
58_D	63_H	1.049	0.32
138_P	204_T	1.042	0.31
145_F	175_L	1.038	0.31
52_L	104_F	1.036	0.31
90_A	93_G	1.031	0.31
47_A	102_V	1.027	0.31
163_G	170_V	1.026	0.31
100_L	221_L	1.024	0.31
61_V	95_H	1.016	0.30
196_R	204_T	1.014	0.30
163_G	232_V	0.996	0.29
172_A	198_T	0.995	0.29
42_Q	132_D	0.984	0.29
42_Q	137_T	0.979	0.29
219_R	226_G	0.978	0.29
51_T	95_H	0.973	0.28
29_L	35_A	0.968	0.28
53_L	67_G	0.960	0.28
89_V	223_A	0.960	0.28
35_A	63_H	0.959	0.28
107_V	137_T	0.947	0.27
113_F	181_G	0.943	0.27
84_A	167_D	0.940	0.27
80_T	232_V	0.932	0.27
101_R	132_D	0.927	0.27
47_A	122_T	0.914	0.26
32_S	106_A	0.907	0.26
83_A	86_G	0.897	0.25
68_R	186_S	0.894	0.25
75_S	181_G	0.893	0.25
91_C	96_T	0.890	0.25
156_A	194_A	0.880	0.25
90_A	96_T	0.879	0.25
145_F	206_R	0.877	0.25
68_R	126_T	0.871	0.24
35_A	45_L	0.869	0.24
26_T	36_T	0.866	0.24
49_V	117_G	0.863	0.24
30_I	104_F	0.863	0.24
31_G	182_P	0.860	0.24
49_V	106_A	0.859	0.24
68_R	77_G	0.854	0.24
76_G	173_V	0.854	0.24
130_L	158_P	0.843	0.23
38_T	111_T	0.841	0.23
140_L	163_G	0.834	0.23
169_T	206_R	0.830	0.23
126_T	198_T	0.821	0.22
159_I	221_L	0.817	0.22
138_P	196_R	0.812	0.22
75_S	227_L	0.808	0.22
99_A	103_R	0.807	0.22
141_V	161_I	0.803	0.22
161_I	196_R	0.803	0.22
131_K	150_T	0.802	0.22
71_D	117_G	0.794	0.22
145_F	232_V	0.792	0.21
86_G	104_F	0.784	0.21
184_A	209_L	0.783	0.21
61_V	90_A	0.780	0.21
93_G	138_P	0.775	0.21
31_G	52_L	0.773	0.21
148_L	162_Y	0.772	0.21
47_A	90_A	0.764	0.20
116_A	119_D	0.757	0.20
41_S	123_V	0.756	0.20
146_Q	203_A	0.746	0.20
121_T	178_V	0.738	0.20
35_A	58_D	0.737	0.20
63_H	192_V	0.735	0.20
60_V	112_A	0.735	0.20
49_V	98_G	0.732	0.19
67_G	93_G	0.729	0.19
49_V	232_V	0.729	0.19
146_Q	169_T	0.725	0.19
122_T	181_G	0.724	0.19
209_L	213_A	0.723	0.19
219_R	223_A	0.723	0.19
154_T	159_I	0.722	0.19
38_T	99_A	0.719	0.19
93_G	213_A	0.717	0.19
189_Q	225_R	0.717	0.19
200_H	203_A	0.714	0.19
102_V	233_S	0.713	0.19
38_T	98_G	0.712	0.19
103_R	146_Q	0.710	0.19
49_V	112_A	0.708	0.19
121_T	125_G	0.708	0.19
65_A	121_T	0.704	0.19
208_I	230_S	0.699	0.18
75_S	93_G	0.699	0.18
164_R	170_V	0.698	0.18
163_G	173_V	0.698	0.18
90_A	181_G	0.694	0.18
48_G	71_D	0.692	0.18
45_L	50_R	0.690	0.18
48_G	74_A	0.688	0.18
34_V	47_A	0.686	0.18
59_T	68_R	0.685	0.18
42_Q	140_L	0.685	0.18
58_D	75_S	0.684	0.18
98_G	163_G	0.681	0.18
59_T	173_V	0.680	0.18
38_T	101_R	0.679	0.18
53_L	146_Q	0.678	0.18
43_R	212_P	0.675	0.18
51_T	56_P	0.674	0.18
99_A	107_V	0.672	0.18
114_D	208_I	0.671	0.18
154_T	221_L	0.671	0.18
88_T	96_T	0.669	0.17
92_D	102_V	0.668	0.17
37_L	72_A	0.664	0.17
91_C	98_G	0.663	0.17
48_G	117_G	0.661	0.17
58_D	218_T	0.660	0.17
148_L	170_V	0.659	0.17
30_I	173_V	0.655	0.17
107_V	165_D	0.652	0.17
63_H	178_V	0.651	0.17
145_F	173_V	0.650	0.17
206_R	230_S	0.648	0.17
53_L	75_S	0.647	0.17
102_V	166_A	0.647	0.17
84_A	228_T	0.643	0.17
129_A	175_L	0.636	0.17
38_T	103_R	0.632	0.16
81_V	155_P	0.632	0.16
142_E	165_D	0.632	0.16
139_D	146_Q	0.631	0.16
62_V	86_G	0.629	0.16
153_D	205_V	0.627	0.16
35_A	53_L	0.626	0.16
193_A	232_V	0.625	0.16
132_D	141_V	0.624	0.16
128_A	159_I	0.623	0.16
88_T	98_G	0.622	0.16
83_A	109_T	0.621	0.16
90_A	102_V	0.621	0.16
140_L	232_V	0.620	0.16
38_T	42_Q	0.617	0.16
32_S	108_H	0.616	0.16
115_A	226_G	0.615	0.16
53_L	58_D	0.610	0.16
97_A	209_L	0.607	0.16
90_A	94_G	0.605	0.16
32_S	86_G	0.600	0.16
46_A	161_I	0.594	0.15
42_Q	129_A	0.593	0.15
165_D	169_T	0.593	0.15
86_G	168_G	0.591	0.15
125_G	159_I	0.589	0.15
38_T	167_D	0.589	0.15
48_G	77_G	0.588	0.15
170_V	203_A	0.588	0.15
97_A	162_Y	0.587	0.15
94_G	103_R	0.582	0.15
93_G	206_R	0.582	0.15
180_A	184_A	0.582	0.15
154_T	183_A	0.582	0.15
61_V	91_C	0.581	0.15
117_G	228_T	0.579	0.15
90_A	97_A	0.579	0.15
141_V	226_G	0.578	0.15
215_T	227_L	0.578	0.15
146_Q	181_G	0.577	0.15
37_L	40_R	0.577	0.15
128_A	134_V	0.577	0.15
170_V	232_V	0.577	0.15
81_V	86_G	0.576	0.15
154_T	158_P	0.576	0.15
52_L	93_G	0.576	0.15
54_W	60_V	0.574	0.15
88_T	94_G	0.574	0.15
173_V	210_V	0.572	0.15
184_A	234_P	0.572	0.15
143_P	153_D	0.572	0.15
77_G	182_P	0.571	0.15
143_P	204_T	0.569	0.15
138_P	142_E	0.569	0.15
153_D	220_R	0.568	0.15
111_T	143_P	0.567	0.15
45_L	186_S	0.564	0.15
154_T	211_A	0.561	0.14
123_V	126_T	0.558	0.14
66_S	89_V	0.558	0.14
75_S	102_V	0.558	0.14
86_G	114_D	0.557	0.14
30_I	44_D	0.557	0.14
87_L	107_V	0.556	0.14
98_G	230_S	0.554	0.14
62_V	93_G	0.553	0.14
28_S	95_H	0.552	0.14
93_G	105_D	0.549	0.14
38_T	132_D	0.549	0.14
116_A	225_R	0.545	0.14
38_T	95_H	0.544	0.14
66_S	93_G	0.541	0.14
80_T	91_C	0.540	0.14
34_V	105_D	0.539	0.14
54_W	146_Q	0.539	0.14
133_R	149_A	0.538	0.14
63_H	227_L	0.538	0.14
123_V	131_K	0.537	0.14
123_V	234_P	0.535	0.14
133_R	178_V	0.534	0.14
61_V	121_T	0.530	0.14
143_P	167_D	0.530	0.14
149_A	154_T	0.529	0.14
156_A	173_V	0.528	0.14
106_A	128_A	0.527	0.14
146_Q	166_A	0.523	0.14
90_A	99_A	0.522	0.14
67_G	200_H	0.520	0.13
54_W	103_R	0.517	0.13
134_V	147_P	0.517	0.13
60_V	119_D	0.516	0.13
89_V	167_D	0.513	0.13
33_C	50_R	0.513	0.13
128_A	205_V	0.512	0.13
28_S	164_R	0.511	0.13
155_P	159_I	0.510	0.13
209_L	215_T	0.508	0.13
132_D	181_G	0.507	0.13
67_G	140_L	0.506	0.13
122_T	138_P	0.505	0.13
72_A	221_L	0.504	0.13
122_T	230_S	0.503	0.13
32_S	47_A	0.500	0.13
107_V	172_A	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vldA	2	0.9417	100	0.281	Contact Map
1y88A	5	0.4375	97.3	0.919	Contact Map
2wcwA	2	0.4042	95.2	0.935	Contact Map
3h1tA	1	0.4042	93.9	0.939	Contact Map
1gefA	2	0.4417	92.5	0.942	Contact Map
2eo0A	2	0.425	89.7	0.946	Contact Map
1ob8A	1	0.3875	88.3	0.947	Contact Map
3fovA	2	0.3833	81.5	0.952	Contact Map
1hh1A	2	0.4167	76.5	0.954	Contact Map
4qbnA	2	0.3875	71.6	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.