GUAAA - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GUAAA - GMP synthase [glutamine-hydrolyzing] subunit A

UniProt:	Q9HSH4	Sequences: MTHILVVDNHGQFTHLEHRLLRDMDGVTVDLTDNTTPPADIDADGLVLSGGPTMADIGHCREYLTLDVPILGVCLGHQLIADELGGRIEAGDYGGYADVTVSISDADDPLVGSLAPDTRVWASHADEVVAVPDGFTITAESDICGVEAMGDTDRDLYGVQWHPEVAHTEEGEAVFENFVAICE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	183 (169)
Sequences:	11987 (6569)
Seq/√Len:	505.3

ECOLI - TRPGD GUAA PABA CARA
BACSU - GUAA PABA CARA CARX
HALSA - GUAAA TRPG CARA Q9HMK6
SULSO - TRPG GUAAA CARA Q97X97

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
81_A	128_V	3.210	1.00
80_I	156_L	2.832	1.00
56_D	82_D	2.500	1.00
24_M	176_E	2.487	1.00
5_L	32_T	2.448	1.00
138_T	150_G	2.378	1.00
81_A	149_M	2.372	1.00
115_A	170_E	2.357	1.00
151_D	154_R	2.338	1.00
37_P	40_D	2.322	1.00
21_L	47_V	2.312	1.00
23_D	172_E	2.300	1.00
136_T	152_T	2.286	1.00
136_T	150_G	2.228	1.00
137_I	146_V	2.131	1.00
170_E	173_A	2.021	1.00
20_L	172_E	1.930	1.00
6_V	18_H	1.887	1.00
139_A	148_A	1.855	1.00
77_H	158_G	1.833	1.00
87_R	130_A	1.828	1.00
9_N	48_L	1.796	1.00
151_D	155_D	1.788	1.00
119_R	169_E	1.778	1.00
89_E	127_E	1.752	1.00
61_R	79_L	1.712	1.00
118_T	170_E	1.709	1.00
176_E	180_A	1.675	1.00
173_A	176_E	1.663	1.00
150_G	157_Y	1.604	1.00
149_M	158_G	1.564	1.00
134_G	153_D	1.492	1.00
96_Y	125_A	1.474	1.00
128_V	149_M	1.458	1.00
137_I	140_E	1.456	1.00
80_I	158_G	1.455	1.00
99_V	121_W	1.452	1.00
17_E	73_V	1.449	1.00
114_L	118_T	1.427	1.00
6_V	47_V	1.412	1.00
27_V	179_V	1.400	1.00
32_T	36_T	1.384	1.00
30_D	43_A	1.378	1.00
45_G	178_F	1.374	1.00
4_I	45_G	1.368	1.00
56_D	87_R	1.359	1.00
62_E	65_T	1.340	1.00
101_V	119_R	1.310	1.00
10_H	35_T	1.309	1.00
127_E	145_G	1.304	1.00
84_L	156_L	1.303	1.00
92_D	145_G	1.294	1.00
134_G	152_T	1.281	1.00
100_T	117_D	1.267	1.00
47_V	71_L	1.257	1.00
81_A	86_G	1.255	1.00
89_E	129_V	1.251	1.00
121_W	167_H	1.242	1.00
101_V	117_D	1.236	1.00
111_V	148_A	1.211	1.00
77_H	128_V	1.208	1.00
24_M	175_F	1.169	1.00
88_I	128_V	1.166	1.00
118_T	174_V	1.157	1.00
102_S	120_V	1.142	1.00
17_E	175_F	1.136	1.00
4_I	27_V	1.128	1.00
135_F	149_M	1.126	1.00
135_F	151_D	1.115	1.00
140_E	144_C	1.109	1.00
20_L	23_D	1.106	1.00
48_L	70_I	1.102	1.00
103_I	140_E	1.101	1.00
36_T	40_D	1.095	1.00
67_D	154_R	1.089	1.00
65_T	154_R	1.072	1.00
91_G	127_E	1.067	1.00
99_V	119_R	1.066	1.00
61_R	65_T	1.063	1.00
109_P	157_Y	1.059	1.00
16_L	19_R	1.046	1.00
74_C	162_H	1.042	1.00
5_L	41_I	1.033	1.00
18_H	22_R	1.028	1.00
71_L	159_V	1.028	1.00
9_N	34_N	1.027	1.00
134_G	151_D	1.014	1.00
65_T	156_L	1.006	1.00
81_A	132_P	1.005	1.00
24_M	172_E	1.005	1.00
141_S	145_G	1.003	1.00
102_S	117_D	1.001	1.00
37_P	41_I	1.000	1.00
77_H	149_M	0.999	1.00
131_V	137_I	0.995	1.00
46_L	68_V	0.992	1.00
84_L	135_F	0.989	1.00
6_V	13_F	0.984	1.00
152_T	155_D	0.981	1.00
86_G	132_P	0.967	1.00
131_V	146_V	0.967	1.00
161_W	174_V	0.963	1.00
54_M	57_I	0.958	1.00
5_L	43_A	0.953	1.00
102_S	140_E	0.952	1.00
22_R	29_V	0.950	1.00
115_A	169_E	0.947	1.00
109_P	150_G	0.928	1.00
120_V	168_T	0.928	1.00
7_V	32_T	0.926	1.00
63_Y	66_L	0.918	1.00
90_A	94_G	0.918	1.00
53_T	57_I	0.913	1.00
73_V	159_V	0.909	1.00
61_R	83_E	0.902	1.00
19_R	22_R	0.899	1.00
114_L	170_E	0.894	1.00
138_T	157_Y	0.889	1.00
93_Y	143_I	0.882	1.00
45_G	179_V	0.881	1.00
138_T	148_A	0.877	1.00
63_Y	67_D	0.877	1.00
139_A	161_W	0.873	1.00
103_I	117_D	0.872	1.00
24_M	179_V	0.867	1.00
10_H	33_D	0.867	1.00
84_L	151_D	0.846	1.00
159_V	163_P	0.830	1.00
110_L	157_Y	0.827	1.00
150_G	177_N	0.826	1.00
61_R	64_L	0.825	1.00
21_L	27_V	0.818	1.00
13_F	18_H	0.811	1.00
115_A	118_T	0.807	1.00
100_T	142_D	0.804	1.00
39_A	63_Y	0.803	1.00
54_M	126_D	0.802	1.00
21_L	179_V	0.797	1.00
157_Y	178_F	0.797	1.00
66_L	154_R	0.795	1.00
4_I	21_L	0.794	1.00
86_G	130_A	0.791	1.00
6_V	21_L	0.786	1.00
32_T	40_D	0.777	1.00
118_T	171_G	0.776	1.00
43_A	68_V	0.776	1.00
56_D	88_I	0.775	1.00
122_A	147_E	0.772	1.00
74_C	78_Q	0.772	1.00
21_L	175_F	0.769	1.00
172_E	176_E	0.768	1.00
38_P	41_I	0.767	1.00
114_L	173_A	0.767	1.00
111_V	161_W	0.759	1.00
26_G	29_V	0.759	1.00
113_S	177_N	0.753	1.00
51_G	75_L	0.741	1.00
62_E	66_L	0.740	1.00
130_A	133_D	0.739	1.00
14_T	31_L	0.739	1.00
15_H	18_H	0.732	1.00
54_M	90_A	0.732	1.00
8_D	14_T	0.730	1.00
18_H	31_L	0.724	1.00
84_L	154_R	0.723	1.00
47_V	178_F	0.722	1.00
5_L	30_D	0.721	1.00
100_T	119_R	0.720	1.00
111_V	177_N	0.718	1.00
19_R	23_D	0.716	1.00
27_V	45_G	0.706	1.00
7_V	41_I	0.705	1.00
46_L	70_I	0.702	1.00
94_G	125_A	0.700	1.00
86_G	128_V	0.695	1.00
16_L	20_L	0.694	1.00
151_D	156_L	0.693	1.00
33_D	36_T	0.689	1.00
103_I	116_P	0.688	1.00
103_I	142_D	0.685	1.00
109_P	112_G	0.681	1.00
6_V	49_S	0.678	1.00
82_D	87_R	0.676	1.00
14_T	49_S	0.673	1.00
6_V	14_T	0.661	1.00
38_P	63_Y	0.653	1.00
54_M	82_D	0.649	1.00
159_V	174_V	0.646	1.00
36_T	41_I	0.645	1.00
71_L	174_V	0.640	1.00
6_V	29_V	0.640	1.00
53_T	56_D	0.639	1.00
112_G	180_A	0.638	1.00
98_D	121_W	0.636	1.00
88_I	126_D	0.635	1.00
118_T	173_A	0.632	1.00
61_R	67_D	0.632	1.00
79_L	83_E	0.629	1.00
111_V	139_A	0.627	1.00
45_G	71_L	0.623	1.00
113_S	173_A	0.614	1.00
70_I	80_I	0.612	1.00
96_Y	123_S	0.605	0.99
161_W	171_G	0.605	0.99
121_W	165_V	0.604	0.99
7_V	37_P	0.603	0.99
20_L	175_F	0.597	0.99
62_E	83_E	0.596	0.99
9_N	79_L	0.595	0.99
123_S	126_D	0.594	0.99
7_V	36_T	0.593	0.99
61_R	66_L	0.590	0.99
133_D	152_T	0.590	0.99
65_T	84_L	0.586	0.99
176_E	179_V	0.584	0.99
54_M	88_I	0.581	0.99
173_A	177_N	0.579	0.99
78_Q	160_Q	0.578	0.99
95_G	141_S	0.573	0.99
50_G	74_C	0.567	0.99
61_R	70_I	0.565	0.99
46_L	63_Y	0.565	0.99
146_V	149_M	0.563	0.99
35_T	60_C	0.560	0.99
34_N	60_C	0.560	0.99
121_W	168_T	0.555	0.99
57_I	60_C	0.555	0.99
29_V	47_V	0.555	0.99
29_V	32_T	0.551	0.99
121_W	169_E	0.549	0.99
58_G	79_L	0.547	0.99
42_D	68_V	0.546	0.99
45_G	69_P	0.543	0.99
132_P	149_M	0.541	0.99
131_V	135_F	0.540	0.99
177_N	180_A	0.538	0.99
133_D	136_T	0.529	0.99
80_I	149_M	0.529	0.99
127_E	144_C	0.526	0.99
95_G	98_D	0.525	0.99
101_V	142_D	0.524	0.99
109_P	138_T	0.520	0.98
7_V	34_N	0.520	0.98
127_E	143_I	0.517	0.98
95_G	100_T	0.516	0.98
38_P	60_C	0.511	0.98
87_R	129_V	0.511	0.98
111_V	115_A	0.509	0.98
112_G	115_A	0.508	0.98
91_G	94_G	0.507	0.98
71_L	157_Y	0.504	0.98
101_V	139_A	0.504	0.98
129_V	132_P	0.501	0.98
38_P	62_E	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3tqiA	3	0.929	100	0.21	Contact Map
2ywbA	4	0.9563	100	0.215	Contact Map
1gpmA	3	0.9891	100	0.217	Contact Map
2vxoA	2	0.9672	100	0.229	Contact Map
3uowA	2	0.9836	100	0.257	Contact Map
3r75A	2	0.9727	100	0.309	Contact Map
2vpiA	1	0.9344	100	0.318	Contact Map
1i1qB	1	0.9454	100	0.322	Contact Map
1a9xB	1	0.9454	100	0.322	Contact Map
1qdlB	2	0.9781	100	0.323	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.