Q9HSH2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSH2 - Uncharacterized protein

UniProt:	Q9HSH2	Sequences: MALRLAVPAMTAQLPPGVTHVDCSTLDMPNAYVVVDDNETTLVDAGWPGDEQTVRDGLHTAGVEPGDIDRVLVTHYDADHVGTLARLTPALDAPVYVHERDAPYVAGDRLPPWTARNGIGALHRLYYRRLDLPDLPIRAVVDGDDIGGFHAYHTPGHTPGHVAYVHEDLSVAFLGDLAYGLGDRLKPTGWLTSSDAAAVESSVRSLCRRAPAFEYACPGHGPPLPDGDDRLAEALP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	236 (188)
Sequences:	16096 (12081)
Seq/√Len:	881.1

ECOLI - YCBL GLO2 YJCS
BACSU - YFLN YOBT YYBB YQJP YQGX PKSB YTNP YRKH
HALSA - Q9HSH2 Q9HNJ9 Q9HRG5 Q9HSD1 Q9HQ50 Q9HNJ2 Q9HQ42 O54647 O54661 Q9HS22
SULSO - Q97XZ1 Q97YZ2 Q97VU0 Q97VU4 Q97UR2 Q97U88 Q97UV2 Q97Y13 Q7LYK3 Q97YH8 Q97WC2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
154_T	163_A	4.610	1.00
39_E	69_D	3.975	1.00
73_V	84_L	3.746	1.00
70_R	96_Y	3.143	1.00
72_L	164_Y	2.755	1.00
150_H	167_E	2.598	1.00
99_E	141_V	2.517	1.00
94_P	138_R	2.291	1.00
145_D	148_G	2.278	1.00
151_A	162_V	2.263	1.00
43_V	74_T	2.245	1.00
41_T	70_R	2.239	1.00
195_D	198_A	2.200	1.00
166_H	169_L	2.199	1.00
32_Y	217_C	2.152	1.00
149_F	166_H	2.099	1.00
101_D	160_G	2.096	1.00
151_A	164_Y	2.079	1.00
35_V	40_T	2.051	1.00
96_Y	138_R	2.037	1.00
70_R	94_P	2.025	1.00
170_S	214_E	1.956	1.00
145_D	150_H	1.948	1.00
98_H	162_V	1.912	1.00
98_H	153_H	1.879	1.00
142_D	205_S	1.856	1.00
171_V	217_C	1.827	1.00
40_T	63_V	1.769	1.00
150_H	165_V	1.741	1.00
141_V	144_D	1.712	1.00
32_Y	173_F	1.704	1.00
55_R	90_A	1.661	1.00
102_A	106_A	1.628	1.00
161_H	175_G	1.583	1.00
163_A	172_A	1.573	1.00
57_G	60_T	1.566	1.00
43_V	173_F	1.527	1.00
96_Y	140_V	1.522	1.00
165_V	172_A	1.521	1.00
88_T	137_I	1.488	1.00
39_E	70_R	1.477	1.00
40_T	68_I	1.465	1.00
55_R	59_H	1.451	1.00
57_G	61_A	1.441	1.00
68_I	93_A	1.418	1.00
152_Y	165_V	1.406	1.00
205_S	208_R	1.401	1.00
198_A	201_S	1.400	1.00
99_E	139_A	1.398	1.00
35_V	63_V	1.389	1.00
140_V	162_V	1.375	1.00
165_V	170_S	1.357	1.00
41_T	72_L	1.357	1.00
201_S	204_R	1.341	1.00
84_L	95_V	1.321	1.00
102_A	139_A	1.314	1.00
74_T	175_G	1.298	1.00
45_A	71_V	1.297	1.00
154_T	202_S	1.294	1.00
43_V	164_Y	1.287	1.00
204_R	208_R	1.269	1.00
185_L	188_T	1.262	1.00
97_V	101_D	1.246	1.00
165_V	214_E	1.230	1.00
51_E	86_R	1.213	1.00
85_A	89_P	1.204	1.00
42_L	68_I	1.201	1.00
56_D	59_H	1.185	1.00
138_R	144_D	1.175	1.00
56_D	60_T	1.173	1.00
163_A	206_L	1.169	1.00
174_L	216_A	1.155	1.00
39_E	64_E	1.150	1.00
177_L	206_L	1.142	1.00
158_T	161_H	1.139	1.00
215_Y	223_P	1.128	1.00
154_T	161_H	1.125	1.00
40_T	69_D	1.125	1.00
143_G	150_H	1.108	1.00
101_D	158_T	1.106	1.00
51_E	55_R	1.104	1.00
197_A	201_S	1.078	1.00
156_G	202_S	1.061	1.00
85_A	88_T	1.055	1.00
196_A	200_E	1.050	1.00
41_T	149_F	1.050	1.00
33_V	40_T	1.049	1.00
152_Y	205_S	1.028	1.00
100_R	103_P	1.017	1.00
100_R	153_H	1.012	1.00
184_R	187_P	1.008	1.00
86_R	90_A	1.006	1.00
36_D	39_E	1.005	1.00
155_P	202_S	1.005	1.00
73_V	95_V	0.998	1.00
52_Q	56_D	0.998	1.00
55_R	91_L	0.996	1.00
88_T	95_V	0.993	1.00
45_A	84_L	0.978	1.00
72_L	162_V	0.968	1.00
51_E	83_T	0.958	1.00
34_V	43_V	0.957	1.00
216_A	224_L	0.952	1.00
142_D	153_H	0.951	1.00
43_V	72_L	0.941	1.00
103_P	107_G	0.937	1.00
50_D	53_T	0.937	1.00
163_A	177_L	0.919	1.00
165_V	213_F	0.917	1.00
203_V	207_C	0.916	1.00
170_S	213_F	0.916	1.00
165_V	209_R	0.915	1.00
53_T	57_G	0.911	1.00
68_I	91_L	0.910	1.00
31_A	54_V	0.909	1.00
204_R	207_C	0.908	1.00
167_E	170_S	0.907	1.00
152_Y	163_A	0.904	1.00
74_T	164_Y	0.904	1.00
42_L	45_A	0.890	1.00
171_V	215_Y	0.881	1.00
71_V	93_A	0.879	1.00
126_Y	129_R	0.878	1.00
154_T	177_L	0.877	1.00
71_V	84_L	0.877	1.00
200_E	204_R	0.871	1.00
140_V	164_Y	0.869	1.00
99_E	103_P	0.866	1.00
32_Y	219_G	0.863	1.00
59_H	90_A	0.859	1.00
76_Y	97_V	0.843	1.00
125_L	128_R	0.843	1.00
71_V	95_V	0.836	1.00
107_G	110_L	0.835	1.00
150_H	209_R	0.834	1.00
218_P	221_G	0.826	1.00
172_A	209_R	0.826	1.00
76_Y	101_D	0.823	1.00
206_L	226_D	0.821	1.00
33_V	42_L	0.819	1.00
199_V	203_V	0.816	1.00
215_Y	225_P	0.812	1.00
97_V	105_V	0.805	1.00
53_T	56_D	0.805	1.00
216_A	226_D	0.804	1.00
30_N	221_G	0.792	1.00
99_E	102_A	0.783	1.00
124_R	127_Y	0.778	1.00
140_V	144_D	0.774	1.00
184_R	188_T	0.773	1.00
134_D	137_I	0.762	1.00
101_D	104_Y	0.760	1.00
180_G	222_P	0.757	1.00
89_P	132_L	0.748	1.00
177_L	199_V	0.746	1.00
80_H	176_D	0.741	1.00
94_P	137_I	0.739	1.00
196_A	199_V	0.735	1.00
172_A	216_A	0.734	1.00
148_G	168_D	0.731	1.00
35_V	57_G	0.730	1.00
179_Y	182_G	0.726	1.00
42_L	58_L	0.718	1.00
97_V	102_A	0.716	1.00
205_S	209_R	0.710	1.00
73_V	81_V	0.707	1.00
217_C	223_P	0.701	1.00
103_P	106_A	0.700	1.00
159_P	198_A	0.700	1.00
52_Q	55_R	0.700	1.00
152_Y	209_R	0.697	1.00
140_V	151_A	0.696	1.00
83_T	86_R	0.693	1.00
31_A	46_G	0.692	1.00
131_D	135_L	0.691	1.00
201_S	205_S	0.690	1.00
145_D	167_E	0.689	1.00
212_A	227_G	0.686	1.00
58_L	68_I	0.681	1.00
29_P	46_G	0.680	1.00
177_L	202_S	0.678	1.00
72_L	149_F	0.677	1.00
78_A	82_G	0.676	1.00
140_V	146_I	0.674	1.00
125_L	129_R	0.673	1.00
45_A	83_T	0.673	1.00
161_H	177_L	0.669	1.00
69_D	94_P	0.669	1.00
40_T	58_L	0.669	1.00
183_D	186_K	0.667	1.00
33_V	58_L	0.663	1.00
108_D	111_P	0.660	1.00
86_R	89_P	0.656	1.00
148_G	167_E	0.655	1.00
149_F	164_Y	0.651	1.00
59_H	62_G	0.651	1.00
109_R	112_P	0.650	1.00
84_L	88_T	0.649	1.00
173_F	217_C	0.649	1.00
31_A	45_A	0.646	1.00
35_V	61_A	0.646	1.00
182_G	188_T	0.641	1.00
144_D	151_A	0.641	1.00
42_L	54_V	0.640	1.00
174_L	218_P	0.640	1.00
58_L	63_V	0.640	1.00
75_H	176_D	0.638	1.00
104_Y	159_P	0.637	1.00
34_V	166_H	0.637	1.00
209_R	213_F	0.621	1.00
126_Y	130_L	0.620	1.00
110_L	113_W	0.619	1.00
192_T	195_D	0.616	1.00
71_V	87_L	0.615	1.00
127_Y	130_L	0.615	1.00
70_R	138_R	0.614	1.00
85_A	132_L	0.609	1.00
88_T	92_D	0.604	1.00
29_P	32_Y	0.603	1.00
26_L	29_P	0.601	1.00
100_R	159_P	0.601	1.00
90_A	93_A	0.601	1.00
170_S	212_A	0.600	1.00
34_V	149_F	0.599	1.00
30_N	219_G	0.595	1.00
185_L	189_G	0.594	1.00
183_D	188_T	0.592	1.00
209_R	212_A	0.590	1.00
33_V	57_G	0.590	1.00
213_F	216_A	0.588	1.00
79_D	220_H	0.584	1.00
133_P	136_P	0.583	1.00
59_H	64_E	0.581	1.00
179_Y	221_G	0.578	1.00
54_V	83_T	0.574	1.00
193_S	196_A	0.574	1.00
174_L	178_A	0.572	1.00
106_A	135_L	0.571	1.00
166_H	171_V	0.568	1.00
32_Y	35_V	0.565	1.00
96_Y	144_D	0.564	1.00
36_D	41_T	0.560	1.00
140_V	143_G	0.558	1.00
216_A	220_H	0.554	1.00
159_P	193_S	0.554	1.00
98_H	101_D	0.552	1.00
182_G	187_P	0.548	1.00
184_R	189_G	0.547	1.00
76_Y	81_V	0.545	1.00
70_R	73_V	0.545	1.00
47_W	50_D	0.545	1.00
143_G	153_H	0.544	1.00
178_A	203_V	0.542	1.00
143_G	205_S	0.541	1.00
126_Y	131_D	0.541	1.00
193_S	199_V	0.539	1.00
25_T	29_P	0.539	1.00
44_D	75_H	0.539	1.00
38_N	62_G	0.534	1.00
194_S	197_A	0.533	1.00
108_D	112_P	0.530	1.00
34_V	41_T	0.528	1.00
41_T	69_D	0.526	1.00
81_V	105_V	0.525	1.00
198_A	202_S	0.523	1.00
64_E	69_D	0.523	1.00
30_N	218_P	0.522	1.00
44_D	176_D	0.521	1.00
81_V	84_L	0.517	1.00
40_T	62_G	0.516	1.00
37_D	40_T	0.515	1.00
157_H	160_G	0.513	1.00
59_H	91_L	0.511	1.00
125_L	130_L	0.510	1.00
152_Y	172_A	0.510	1.00
207_C	212_A	0.507	1.00
101_D	105_V	0.507	1.00
42_L	87_L	0.506	1.00
172_A	214_E	0.505	1.00
163_A	202_S	0.505	1.00
77_D	80_H	0.501	1.00
179_Y	183_D	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zo4A	1	0.9237	100	0.316	Contact Map
2cfuA	2	0.9661	100	0.343	Contact Map
2yheA	3	0.9831	100	0.345	Contact Map
4nurA	2	0.9831	100	0.35	Contact Map
2fhxA	2	0.9449	100	0.362	Contact Map
4pdxA	2	0.9619	100	0.366	Contact Map
2vw8A	2	0.9576	100	0.374	Contact Map
1k07A	1	0.9322	100	0.377	Contact Map
3iogA	1	0.9025	100	0.38	Contact Map
3q6vA	1	0.9068	100	0.383	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.