RL37A - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL37A - 50S ribosomal protein L37Ae

UniProt:	Q9HSG8	Sequences: MANQSSTGSAGRFGARYGRVSRRRVSDIEGTMNEDHACPDCGSEAVSREGTGIWQCGKCGYKYAGGAYQPQTPSGKTVTRSIRTALGETGDSNSE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	95 (87)
Sequences:	381 (197)
Seq/√Len:	21.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
83_R	87_G	4.035	1.00
55_Q	62_K	2.927	0.99
38_C	41_C	2.868	0.99
46_V	70_P	2.864	0.99
29_E	32_M	2.278	0.96
54_W	59_C	2.182	0.95
6_S	36_H	1.980	0.92
3_N	8_G	1.963	0.91
25_V	29_E	1.882	0.89
66_G	72_T	1.728	0.85
19_R	23_R	1.662	0.82
37_A	44_E	1.650	0.82
24_R	28_I	1.593	0.79
25_V	44_E	1.553	0.78
21_S	42_G	1.525	0.76
9_S	26_S	1.482	0.74
51_T	68_Y	1.478	0.74
79_T	86_L	1.471	0.74
24_R	89_T	1.468	0.73
46_V	49_E	1.439	0.72
56_C	59_C	1.438	0.72
34_E	37_A	1.438	0.72
73_P	77_T	1.437	0.72
49_E	55_Q	1.420	0.71
8_G	24_R	1.417	0.71
38_C	59_C	1.395	0.70
45_A	57_G	1.344	0.67
46_V	55_Q	1.307	0.64
16_R	52_G	1.282	0.63
53_I	59_C	1.265	0.62
39_P	88_E	1.187	0.57
40_D	63_Y	1.184	0.57
28_I	82_I	1.145	0.54
14_G	22_R	1.138	0.54
37_A	76_K	1.112	0.52
27_D	64_A	1.109	0.52
54_W	66_G	1.108	0.52
32_M	67_A	1.094	0.51
28_I	53_I	1.053	0.48
19_R	42_G	1.038	0.47
36_H	74_S	1.028	0.46
36_H	42_G	1.013	0.45
8_G	68_Y	0.995	0.44
17_Y	38_C	0.993	0.44
23_R	34_E	0.992	0.44
4_Q	7_T	0.989	0.44
33_N	39_P	0.988	0.44
22_R	41_C	0.987	0.43
9_S	30_G	0.981	0.43
43_S	47_S	0.958	0.42
16_R	22_R	0.945	0.41
20_V	30_G	0.942	0.41
7_T	47_S	0.935	0.40
52_G	56_C	0.924	0.39
25_V	28_I	0.919	0.39
24_R	73_P	0.918	0.39
20_V	23_R	0.915	0.39
68_Y	73_P	0.911	0.39
26_S	32_M	0.911	0.39
8_G	14_G	0.898	0.38
20_V	42_G	0.896	0.38
11_G	17_Y	0.892	0.37
24_R	70_P	0.891	0.37
46_V	89_T	0.857	0.35
8_G	16_R	0.847	0.35
8_G	17_Y	0.832	0.34
15_A	24_R	0.826	0.33
46_V	81_S	0.823	0.33
40_D	49_E	0.811	0.33
53_I	56_C	0.804	0.32
35_D	74_S	0.775	0.30
49_E	57_G	0.773	0.30
15_A	84_T	0.762	0.30
9_S	12_R	0.757	0.29
25_V	58_K	0.743	0.29
26_S	43_S	0.734	0.28
80_R	84_T	0.730	0.28
32_M	43_S	0.730	0.28
19_R	73_P	0.726	0.28
61_Y	69_Q	0.717	0.27
8_G	22_R	0.715	0.27
26_S	40_D	0.711	0.27
16_R	65_G	0.711	0.27
11_G	68_Y	0.711	0.27
45_A	62_K	0.709	0.27
15_A	21_S	0.686	0.26
50_G	58_K	0.684	0.26
7_T	71_Q	0.684	0.26
5_S	9_S	0.682	0.25
15_A	51_T	0.676	0.25
28_I	39_P	0.672	0.25
46_V	68_Y	0.666	0.25
76_K	89_T	0.664	0.25
58_K	70_P	0.662	0.24
10_A	60_G	0.660	0.24
48_R	64_A	0.648	0.24
61_Y	71_Q	0.643	0.24
8_G	54_W	0.634	0.23
46_V	60_G	0.634	0.23
11_G	65_G	0.632	0.23
45_A	58_K	0.630	0.23
45_A	49_E	0.626	0.23
27_D	75_G	0.625	0.23
40_D	61_Y	0.603	0.22
42_G	78_V	0.598	0.21
26_S	29_E	0.587	0.21
17_Y	53_I	0.567	0.20
48_R	66_G	0.566	0.20
63_Y	70_P	0.564	0.20
30_G	83_R	0.558	0.20
3_N	43_S	0.553	0.20
21_S	41_C	0.552	0.19
20_V	75_G	0.551	0.19
6_S	43_S	0.550	0.19
4_Q	11_G	0.549	0.19
48_R	67_A	0.549	0.19
6_S	35_D	0.548	0.19
47_S	71_Q	0.544	0.19
78_V	83_R	0.537	0.19
16_R	56_C	0.532	0.19
14_G	28_I	0.531	0.19
45_A	89_T	0.529	0.19
26_S	84_T	0.518	0.18
53_I	60_G	0.514	0.18
46_V	63_Y	0.513	0.18
5_S	69_Q	0.512	0.18
33_N	40_D	0.504	0.18
55_Q	83_R	0.501	0.17
18_G	68_Y	0.501	0.17
81_S	85_A	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4a17Y	1	0.9895	100	0.108	Contact Map
1vx7h	1	0.8842	100	0.114	Contact Map
3zf7o	1	0.9474	100	0.124	Contact Map
4w20p	1	0.9579	100	0.156	Contact Map
4ujrc	1	0.9579	100	0.16	Contact Map
3cc2Z	1	0.7684	100	0.163	Contact Map
3j21i	1	0.8211	100	0.195	Contact Map
1ffkW	1	0.7684	100	0.315	Contact Map
1vq8Z	1	0.7684	100	0.346	Contact Map
3j21g	1	0.4737	98.2	0.794	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.