Q9HSF4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSF4 - Uncharacterized protein

UniProt:	Q9HSF4	Sequences: MSEAQPDARSDARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYPNLDDLVNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADRRERVETIVADD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	116 (88)
Sequences:	277 (115)
Seq/√Len:	12.3

HALSA - Q9HSF4 O52006 Q9HI09 Q9HRD2 Q9HHE2 Q9HPX7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_G	55_P	3.012	0.96
50_H	53_L	2.639	0.92
48_V	62_N	2.300	0.85
71_L	77_E	2.252	0.84
34_L	40_L	2.188	0.82
41_E	48_V	2.076	0.78
26_L	38_R	1.979	0.75
46_E	99_F	1.831	0.69
51_G	68_K	1.759	0.65
63_K	86_D	1.713	0.63
32_Y	40_L	1.637	0.60
69_S	77_E	1.627	0.59
91_D	95_T	1.624	0.59
83_E	86_D	1.591	0.57
92_L	95_T	1.583	0.57
39_E	51_G	1.578	0.57
36_I	57_L	1.549	0.55
12_A	94_W	1.545	0.55
83_E	87_A	1.517	0.54
32_Y	35_A	1.504	0.53
88_V	96_L	1.483	0.52
50_H	65_L	1.462	0.51
21_N	91_D	1.446	0.50
49_N	73_K	1.432	0.49
31_R	77_E	1.408	0.48
48_V	83_E	1.383	0.47
30_A	79_A	1.381	0.47
24_T	91_D	1.348	0.45
55_P	59_D	1.329	0.44
43_Y	94_W	1.326	0.44
64_G	83_E	1.294	0.42
27_G	84_G	1.290	0.42
12_A	31_R	1.288	0.42
14_D	44_Y	1.282	0.42
68_K	94_W	1.277	0.42
16_T	84_G	1.272	0.41
84_G	89_V	1.265	0.41
48_V	69_S	1.234	0.39
55_P	68_K	1.218	0.39
17_A	20_K	1.138	0.35
20_K	59_D	1.123	0.34
52_R	65_L	1.114	0.34
55_P	58_D	1.080	0.32
32_Y	71_L	1.075	0.32
43_Y	81_T	1.072	0.32
68_K	91_D	1.071	0.32
30_A	77_E	1.066	0.32
27_G	95_T	1.050	0.31
62_N	82_N	1.030	0.30
17_A	21_N	1.019	0.30
26_L	31_R	0.999	0.29
55_P	84_G	0.992	0.28
59_D	63_K	0.987	0.28
26_L	80_L	0.982	0.28
51_G	75_T	0.959	0.27
20_K	31_R	0.925	0.26
22_I	59_D	0.922	0.26
19_Q	37_K	0.919	0.26
16_T	19_Q	0.918	0.26
37_K	72_D	0.909	0.25
66_V	79_A	0.908	0.25
36_I	51_G	0.908	0.25
51_G	61_V	0.885	0.24
26_L	66_V	0.881	0.24
13_R	84_G	0.858	0.23
14_D	97_S	0.848	0.23
66_V	85_F	0.833	0.22
36_I	89_V	0.828	0.22
16_T	56_N	0.825	0.22
18_F	74_R	0.807	0.21
30_A	80_L	0.806	0.21
70_E	82_N	0.805	0.21
87_A	90_D	0.804	0.21
27_G	98_K	0.801	0.21
45_G	88_V	0.782	0.21
58_D	84_G	0.774	0.20
13_R	99_F	0.752	0.20
92_L	99_F	0.743	0.19
14_D	50_H	0.743	0.19
39_E	90_D	0.739	0.19
49_N	82_N	0.732	0.19
22_I	85_F	0.731	0.19
21_N	52_R	0.717	0.19
33_G	76_N	0.713	0.18
29_E	61_V	0.702	0.18
29_E	59_D	0.699	0.18
34_L	44_Y	0.693	0.18
14_D	86_D	0.688	0.18
16_T	52_R	0.688	0.18
49_N	72_D	0.681	0.17
20_K	89_V	0.672	0.17
12_A	43_Y	0.653	0.17
34_L	50_H	0.652	0.17
16_T	98_K	0.652	0.17
18_F	75_T	0.651	0.17
33_G	74_R	0.650	0.17
17_A	73_K	0.650	0.17
44_Y	49_N	0.642	0.16
40_L	79_A	0.630	0.16
92_L	96_L	0.629	0.16
82_N	89_V	0.626	0.16
16_T	37_K	0.621	0.16
45_G	58_D	0.612	0.16
32_Y	87_A	0.608	0.15
71_L	85_F	0.602	0.15
20_K	26_L	0.600	0.15
86_D	90_D	0.598	0.15
57_L	78_Y	0.588	0.15
45_G	90_D	0.584	0.15
52_R	80_L	0.583	0.15
31_R	88_V	0.578	0.15
47_E	97_S	0.575	0.15
55_P	79_A	0.571	0.14
50_H	70_E	0.565	0.14
61_V	68_K	0.564	0.14
22_I	47_E	0.564	0.14
38_R	89_V	0.561	0.14
17_A	85_F	0.558	0.14
14_D	66_V	0.556	0.14
18_F	72_D	0.553	0.14
23_L	80_L	0.541	0.14
27_G	39_E	0.540	0.14
53_L	65_L	0.525	0.13
12_A	27_G	0.523	0.13
57_L	75_T	0.522	0.13
12_A	91_D	0.517	0.13
83_E	95_T	0.513	0.13
28_E	31_R	0.510	0.13
63_K	98_K	0.509	0.13
90_D	95_T	0.506	0.13
39_E	68_K	0.500	0.13
32_Y	75_T	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2co5A	2	0.8276	98.7	0.775	Contact Map
3l9fA	2	0.8362	98.7	0.781	Contact Map
1yg2A	2	0.7931	98.6	0.789	Contact Map
2e1nA	2	0.8448	98.4	0.799	Contact Map
2eshA	2	0.8707	98.4	0.8	Contact Map
2zfwA	2	0.7931	98.4	0.801	Contact Map
3elkA	3	0.8707	98.3	0.803	Contact Map
2dqlA	2	0.8966	98.3	0.803	Contact Map
3f8bA	2	0.8534	98.3	0.805	Contact Map
1xmaA	2	0.8103	98.3	0.805	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.