Q9HSD5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSD5 - Uncharacterized protein

UniProt:	Q9HSD5	Sequences: MPRGFDRERTNVHKLQYHFIWCPKYRKSVLTGEVRDRLEELIKEKADELGVEILELAIRPDHVHLFITGDPTLAPNKIMQQIKGYSSRHLRDEFDFGLPSLWTRSYFVSSAGDVSSEVIEEYIDAQAGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	129 (118)
Sequences:	1756 (1163)
Seq/√Len:	107.0

HALSA - Q9HSD5 Q9HSW8 Q9HHX7 Q9HM86
SULSO - Q97Y68

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_R	93_E	4.685	1.00
37_R	94_F	2.571	1.00
42_I	82_I	2.499	1.00
17_Y	69_G	2.345	1.00
55_E	124_D	2.252	1.00
42_I	86_S	2.116	1.00
41_L	86_S	2.112	1.00
51_V	78_I	1.966	1.00
121_E	125_A	1.912	1.00
19_F	79_M	1.904	1.00
19_F	67_I	1.847	1.00
22_C	103_T	1.810	1.00
69_G	75_P	1.796	1.00
49_L	81_Q	1.793	1.00
17_Y	110_S	1.743	1.00
77_K	80_Q	1.690	1.00
66_F	123_I	1.683	1.00
89_H	92_D	1.672	1.00
13_H	108_V	1.643	1.00
37_R	40_E	1.621	1.00
91_R	99_P	1.572	1.00
121_E	124_D	1.551	1.00
88_R	92_D	1.547	1.00
116_S	120_E	1.517	1.00
39_E	43_K	1.483	1.00
22_C	26_R	1.464	1.00
37_R	41_L	1.454	1.00
15_L	69_G	1.400	1.00
45_K	49_L	1.383	1.00
35_R	39_E	1.370	1.00
38_L	90_L	1.367	1.00
45_K	85_Y	1.347	1.00
50_G	72_T	1.342	1.00
30_L	38_L	1.339	0.99
67_I	78_I	1.337	0.99
46_A	53_I	1.337	0.99
120_E	124_D	1.336	0.99
30_L	101_L	1.318	0.99
66_F	116_S	1.318	0.99
87_S	91_R	1.305	0.99
70_D	73_L	1.283	0.99
117_E	120_E	1.283	0.99
15_L	108_V	1.241	0.99
52_E	68_T	1.240	0.99
17_Y	75_P	1.214	0.99
111_A	116_S	1.195	0.99
43_K	47_D	1.187	0.99
75_P	79_M	1.183	0.99
41_L	85_Y	1.165	0.99
69_G	78_I	1.146	0.98
115_S	118_V	1.133	0.98
46_A	51_V	1.123	0.98
44_E	48_E	1.118	0.98
42_I	56_L	1.114	0.98
41_L	89_H	1.101	0.98
46_A	82_I	1.076	0.98
16_Q	111_A	1.070	0.98
19_F	75_P	1.046	0.97
39_E	58_I	1.027	0.97
75_P	108_V	1.026	0.97
46_A	78_I	1.019	0.97
39_E	57_A	1.019	0.97
39_E	56_L	1.016	0.97
13_H	68_T	1.009	0.96
46_A	65_L	1.005	0.96
15_L	75_P	0.996	0.96
73_L	78_I	0.993	0.96
17_Y	108_V	0.987	0.96
74_A	77_K	0.979	0.96
44_E	47_D	0.971	0.96
16_Q	54_L	0.944	0.95
34_V	90_L	0.929	0.94
55_E	120_E	0.928	0.94
42_I	63_V	0.923	0.94
76_N	106_Y	0.917	0.94
30_L	35_R	0.906	0.94
41_L	45_K	0.892	0.93
51_V	73_L	0.887	0.93
18_H	111_A	0.887	0.93
19_F	108_V	0.884	0.93
81_Q	84_G	0.879	0.93
16_Q	68_T	0.877	0.92
58_I	63_V	0.874	0.92
118_V	121_E	0.871	0.92
66_F	111_A	0.870	0.92
81_Q	85_Y	0.870	0.92
35_R	59_R	0.860	0.92
71_P	76_N	0.859	0.92
112_G	115_S	0.858	0.92
38_L	42_I	0.856	0.92
30_L	90_L	0.854	0.91
28_S	61_D	0.845	0.91
14_K	109_S	0.834	0.90
102_W	106_Y	0.829	0.90
32_G	36_D	0.829	0.90
40_E	47_D	0.819	0.90
37_R	90_L	0.818	0.90
45_K	81_Q	0.813	0.89
41_L	44_E	0.809	0.89
40_E	90_L	0.798	0.88
21_W	67_I	0.796	0.88
87_S	100_S	0.793	0.88
67_I	75_P	0.790	0.88
97_G	100_S	0.787	0.88
42_I	65_L	0.777	0.87
67_I	108_V	0.775	0.87
11_N	15_L	0.763	0.86
9_R	105_S	0.763	0.86
87_S	99_P	0.760	0.86
33_E	37_R	0.754	0.85
91_R	100_S	0.748	0.85
54_L	68_T	0.740	0.84
35_R	57_A	0.737	0.84
35_R	58_I	0.735	0.84
80_Q	104_R	0.720	0.83
84_G	87_S	0.718	0.83
74_A	79_M	0.704	0.81
40_E	44_E	0.698	0.81
123_I	126_Q	0.684	0.79
35_R	56_L	0.683	0.79
14_K	68_T	0.680	0.79
46_A	84_G	0.678	0.79
117_E	121_E	0.678	0.79
115_S	123_I	0.675	0.79
43_K	53_I	0.674	0.78
13_H	71_P	0.672	0.78
13_H	17_Y	0.660	0.77
30_L	34_V	0.657	0.77
99_P	103_T	0.652	0.76
90_L	93_E	0.647	0.76
91_R	95_D	0.646	0.75
70_D	74_A	0.644	0.75
53_I	67_I	0.642	0.75
84_G	91_R	0.635	0.74
114_V	119_I	0.631	0.74
49_L	85_Y	0.628	0.73
80_Q	84_G	0.622	0.73
77_K	81_Q	0.618	0.72
23_P	60_P	0.613	0.72
59_R	126_Q	0.611	0.71
30_L	58_I	0.602	0.70
33_E	36_D	0.601	0.70
55_E	63_V	0.595	0.69
15_L	110_S	0.591	0.69
70_D	76_N	0.591	0.69
84_G	100_S	0.588	0.68
18_H	62_H	0.588	0.68
48_E	85_Y	0.586	0.68
36_D	40_E	0.581	0.68
109_S	114_V	0.571	0.66
42_I	53_I	0.569	0.66
46_A	67_I	0.568	0.66
57_A	105_S	0.563	0.65
39_E	59_R	0.562	0.65
40_E	93_E	0.561	0.65
14_K	107_F	0.560	0.65
16_Q	66_F	0.558	0.64
109_S	115_S	0.556	0.64
85_Y	89_H	0.550	0.63
12_V	105_S	0.549	0.63
16_Q	116_S	0.544	0.63
15_L	74_A	0.543	0.62
84_G	88_R	0.539	0.62
31_T	97_G	0.531	0.61
32_G	96_F	0.531	0.61
36_D	47_D	0.530	0.61
18_H	64_H	0.526	0.60
36_D	43_K	0.525	0.60
23_P	59_R	0.525	0.60
114_V	118_V	0.524	0.60
108_V	126_Q	0.524	0.60
77_K	87_S	0.517	0.59
100_S	104_R	0.515	0.58
55_E	66_F	0.513	0.58
85_Y	88_R	0.506	0.57
49_L	84_G	0.503	0.57
22_C	57_A	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vjvA	2	0.938	100	0.342	Contact Map
2f5gA	2	0.9767	100	0.355	Contact Map
2fyxA	2	0.9612	100	0.371	Contact Map
4er8A	1	0.9302	99.9	0.486	Contact Map
2yxoA	3	0.4884	15.6	0.939	Contact Map
3knyA	2	0.7209	15.3	0.939	Contact Map
1jnpA	2	0.2403	12.2	0.942	Contact Map
4nrdA	3	0.5814	12.2	0.942	Contact Map
1ofdA	1	0.8837	10.3	0.943	Contact Map
4m8kA	2	0.5969	9	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.