Q9HSC6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSC6 - Uncharacterized protein

UniProt:	Q9HSC6	Sequences: MNAVGLVAFATVGSLKAIDADFDVLGVAVLGVLTALGGGATRDVLVGSVPAMLQSTTDVGFALAGVVVAVVVARRVGTEVLAHPVVDVPDAVGLAAFAASGALVGVGADVSPFGVVVLGTTTGVGGGLVSDVLLQRVPFVLTEDLYATCAIAGSTVLWVATASGLGATIAAAAGAGVTLAVRLLAIRFEWALPTVRLNAPA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	201 (191)
Sequences:	2526 (1708)
Seq/√Len:	123.6

ECOLI - YICG YADS
BACSU - YVGT
HALSA - Q9HSC6
SULSO - Q981D4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
98_A	150_A	3.712	1.00
20_A	136_R	3.501	1.00
48_S	104_V	3.336	1.00
30_L	134_L	3.255	1.00
31_G	66_V	3.216	1.00
7_V	65_G	3.151	1.00
156_V	177_V	3.057	1.00
184_L	188_F	2.908	1.00
153_G	178_T	2.829	1.00
40_A	52_M	2.775	1.00
33_L	133_L	2.699	1.00
95_A	179_L	2.468	1.00
179_L	183_L	2.463	1.00
92_V	179_L	2.460	1.00
102_A	154_S	2.328	1.00
94_L	123_G	2.218	1.00
106_V	115_V	2.173	1.00
48_S	108_A	2.105	1.00
22_F	134_L	2.067	1.00
120_T	151_I	2.034	1.00
87_D	186_I	2.025	1.00
88_V	183_L	2.014	1.00
184_L	190_W	1.983	1.00
145_L	149_C	1.910	1.00
16_K	134_L	1.909	1.00
172_A	176_G	1.837	1.00
36_L	62_A	1.736	1.00
94_L	150_A	1.732	1.00
160_A	165_L	1.726	1.00
35_A	62_A	1.667	1.00
2_N	58_D	1.634	1.00
159_V	163_S	1.574	1.00
102_A	158_W	1.574	1.00
136_R	142_T	1.554	1.00
46_V	110_V	1.550	1.00
9_F	93_G	1.536	1.00
32_V	62_A	1.510	1.00
149_C	181_V	1.498	1.00
102_A	115_V	1.484	1.00
11_T	69_A	1.483	1.00
116_V	158_W	1.476	1.00
110_V	114_G	1.450	1.00
105_G	118_L	1.450	1.00
115_V	158_W	1.426	1.00
56_T	60_G	1.418	1.00
31_G	62_A	1.417	1.00
5_G	9_F	1.413	1.00
24_V	70_V	1.395	1.00
152_A	181_V	1.370	1.00
133_L	141_L	1.352	1.00
28_A	63_L	1.349	1.00
185_A	190_W	1.349	1.00
45_L	53_L	1.348	1.00
21_D	194_T	1.330	1.00
176_G	180_A	1.311	1.00
41_T	121_T	1.292	1.00
116_V	155_T	1.288	1.00
118_L	122_T	1.279	1.00
60_G	64_A	1.268	1.00
124_V	140_V	1.247	1.00
104_V	108_A	1.246	1.00
171_A	175_A	1.240	0.99
37_G	129_V	1.238	0.99
160_A	170_A	1.233	0.99
25_L	147_A	1.216	0.99
76_V	81_L	1.211	0.99
47_G	50_P	1.211	0.99
41_T	125_G	1.210	0.99
95_A	175_A	1.196	0.99
40_A	125_G	1.174	0.99
95_A	99_A	1.169	0.99
33_L	129_V	1.168	0.99
170_A	174_G	1.164	0.99
112_P	158_W	1.156	0.99
128_L	140_V	1.148	0.99
27_V	70_V	1.141	0.99
7_V	61_F	1.123	0.99
155_T	159_V	1.119	0.99
65_G	69_A	1.113	0.99
91_A	183_L	1.108	0.99
99_A	178_T	1.106	0.99
46_V	108_A	1.101	0.99
91_A	179_L	1.077	0.99
32_V	59_V	1.076	0.99
112_P	116_V	1.076	0.99
98_A	102_A	1.075	0.99
52_M	114_G	1.071	0.98
98_A	178_T	1.048	0.98
28_A	66_V	1.042	0.98
159_V	162_A	1.036	0.98
95_A	153_G	1.035	0.98
47_G	51_A	1.033	0.98
63_L	67_V	1.024	0.98
98_A	154_S	1.023	0.98
102_A	119_G	1.019	0.98
14_S	27_V	1.017	0.98
52_M	125_G	1.017	0.98
6_L	9_F	1.014	0.98
181_V	190_W	0.995	0.98
102_A	157_L	0.992	0.97
149_C	153_G	0.990	0.97
87_D	91_A	0.989	0.97
29_V	141_L	0.984	0.97
29_V	147_A	0.980	0.97
148_T	192_L	0.973	0.97
18_I	27_V	0.972	0.97
12_V	89_P	0.960	0.97
185_A	189_E	0.952	0.97
143_E	191_A	0.944	0.97
166_G	169_I	0.937	0.96
41_T	129_V	0.927	0.96
3_A	61_F	0.925	0.96
6_L	10_A	0.923	0.96
103_L	107_G	0.917	0.96
6_L	36_L	0.915	0.96
152_A	177_V	0.914	0.96
93_G	97_F	0.912	0.96
183_L	187_R	0.906	0.96
96_A	175_A	0.906	0.96
99_A	174_G	0.897	0.95
9_F	12_V	0.886	0.95
138_P	141_L	0.886	0.95
153_G	174_G	0.875	0.95
96_A	100_S	0.863	0.94
157_L	174_G	0.858	0.94
191_A	194_T	0.857	0.94
119_G	174_G	0.845	0.94
123_G	178_T	0.844	0.94
7_V	11_T	0.842	0.94
177_V	181_V	0.839	0.94
11_T	89_P	0.837	0.93
25_L	124_V	0.836	0.93
44_V	49_V	0.832	0.93
120_T	124_V	0.830	0.93
8_A	93_G	0.828	0.93
17_A	27_V	0.825	0.93
2_N	16_K	0.817	0.93
5_G	97_F	0.810	0.92
95_A	178_T	0.810	0.92
114_G	118_L	0.803	0.92
92_V	96_A	0.802	0.92
86_V	89_P	0.796	0.92
40_A	51_A	0.790	0.91
145_L	192_L	0.790	0.91
99_A	160_A	0.785	0.91
68_V	159_V	0.783	0.91
48_S	51_A	0.781	0.91
165_L	170_A	0.780	0.91
116_V	151_I	0.767	0.90
156_V	160_A	0.766	0.90
165_L	169_I	0.764	0.90
145_L	181_V	0.763	0.90
62_A	66_V	0.760	0.90
4_V	190_W	0.757	0.89
103_L	157_L	0.752	0.89
53_L	114_G	0.749	0.89
36_L	59_V	0.744	0.89
137_V	140_V	0.741	0.88
25_L	29_V	0.739	0.88
115_V	119_G	0.736	0.88
128_L	133_L	0.735	0.88
40_A	45_L	0.735	0.88
22_F	137_V	0.728	0.88
11_T	65_G	0.724	0.87
66_V	70_V	0.714	0.87
120_T	147_A	0.711	0.86
20_A	102_A	0.707	0.86
128_L	141_L	0.697	0.85
82_A	85_V	0.696	0.85
64_A	68_V	0.696	0.85
46_V	105_G	0.682	0.84
16_K	20_A	0.682	0.84
99_A	157_L	0.678	0.84
97_F	123_G	0.676	0.83
70_V	195_V	0.671	0.83
23_D	138_P	0.670	0.83
102_A	178_T	0.669	0.83
110_V	115_V	0.668	0.83
169_I	173_A	0.664	0.82
18_I	195_V	0.660	0.82
4_V	8_A	0.658	0.82
156_V	174_G	0.651	0.81
137_V	142_T	0.649	0.81
161_T	170_A	0.648	0.81
18_I	73_A	0.647	0.81
95_A	119_G	0.646	0.81
49_V	53_L	0.646	0.81
14_S	69_A	0.646	0.81
9_F	13_G	0.645	0.81
62_A	70_V	0.645	0.81
24_V	187_R	0.641	0.80
100_S	122_T	0.636	0.80
160_A	174_G	0.635	0.79
55_S	59_V	0.635	0.79
30_L	129_V	0.633	0.79
158_W	161_T	0.630	0.79
183_L	186_I	0.624	0.78
59_V	113_F	0.622	0.78
161_T	167_A	0.618	0.78
46_V	49_V	0.618	0.78
23_D	146_Y	0.616	0.77
14_S	66_V	0.612	0.77
60_G	113_F	0.612	0.77
151_I	154_S	0.612	0.77
157_L	161_T	0.612	0.77
135_Q	184_L	0.612	0.77
45_L	121_T	0.612	0.77
62_A	65_G	0.612	0.77
32_V	36_L	0.609	0.77
71_V	75_R	0.607	0.76
25_L	151_I	0.603	0.76
128_L	139_F	0.602	0.76
152_A	183_L	0.600	0.76
13_G	140_V	0.600	0.76
18_I	69_A	0.600	0.76
3_A	57_T	0.600	0.76
100_S	174_G	0.599	0.75
156_V	173_A	0.599	0.75
94_L	178_T	0.596	0.75
30_L	135_Q	0.596	0.75
173_A	177_V	0.591	0.74
40_A	44_V	0.591	0.74
3_A	7_V	0.588	0.74
128_L	169_I	0.588	0.74
162_A	176_G	0.586	0.74
52_M	157_L	0.582	0.73
34_T	37_G	0.580	0.73
19_D	22_F	0.579	0.73
143_E	178_T	0.579	0.73
26_G	30_L	0.575	0.72
36_L	149_C	0.574	0.72
56_T	111_S	0.574	0.72
149_C	185_A	0.570	0.72
8_A	61_F	0.568	0.72
2_N	11_T	0.567	0.71
59_V	117_V	0.562	0.71
2_N	9_F	0.561	0.71
111_S	118_L	0.561	0.71
106_V	161_T	0.560	0.70
12_V	93_G	0.559	0.70
41_T	45_L	0.559	0.70
33_L	37_G	0.558	0.70
25_L	143_E	0.556	0.70
124_V	147_A	0.555	0.70
111_S	114_G	0.553	0.70
170_A	178_T	0.552	0.69
144_D	189_E	0.550	0.69
4_V	32_V	0.550	0.69
13_G	151_I	0.550	0.69
121_T	129_V	0.550	0.69
32_V	35_A	0.549	0.69
169_I	172_A	0.549	0.69
41_T	140_V	0.547	0.69
142_T	186_I	0.545	0.68
95_A	115_V	0.545	0.68
2_N	100_S	0.541	0.68
95_A	186_I	0.540	0.68
3_A	152_A	0.539	0.68
98_A	153_G	0.538	0.67
30_L	122_T	0.532	0.67
63_L	113_F	0.530	0.66
97_F	182_R	0.530	0.66
7_V	31_G	0.527	0.66
63_L	66_V	0.526	0.66
43_D	104_V	0.525	0.66
88_V	186_I	0.524	0.65
119_G	149_C	0.523	0.65
64_A	173_A	0.522	0.65
22_F	26_G	0.520	0.65
27_V	66_V	0.520	0.65
29_V	117_V	0.519	0.65
86_V	148_T	0.519	0.65
14_S	31_G	0.518	0.65
2_N	96_A	0.517	0.64
6_L	143_E	0.517	0.64
88_V	92_V	0.516	0.64
91_A	115_V	0.514	0.64
99_A	171_A	0.513	0.64
41_T	72_V	0.512	0.64
102_A	150_A	0.510	0.63
17_A	30_L	0.509	0.63
22_F	141_L	0.508	0.63
53_L	111_S	0.506	0.63
15_L	77_G	0.505	0.63
162_A	166_G	0.501	0.62
46_V	104_V	0.500	0.62

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2f2bA	4	0.3881	15.2	0.954	Contact Map
3llqA	3	0.3881	5.8	0.962	Contact Map
2o9gA	3	0.3881	4.8	0.963	Contact Map
3cn5A	3	0.398	2.7	0.968	Contact Map
3fewX	1	0.2587	1.9	0.97	Contact Map
4p02B	1	0.3632	1.9	0.97	Contact Map
2l9uA	2	0.199	1.5	0.972	Contact Map
2mawA	1	0.3234	1.5	0.972	Contact Map
3gd8A	4	0.3682	1.4	0.972	Contact Map
3uhmA	1	0.2935	1.4	0.972	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.