Q9HSC5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSC5 - Uncharacterized protein

UniProt:	Q9HSC5	Sequences: MKGVVLQTTDARLVDIAHDLPRQDVRAAAFWLREVVPYFPPAVHLAVVDPGVGTDRSAVVVRAGSHAIVAPDNGVAVPAARRIAGDAADIDVFEIDVEDPASATFHGRDVFAPAAADIHERGVDTFDQYPEYEPTADYERVSFPAPAVTDGGAAGTVIAVDGFGNAITNLPGEIVADRVGDTVEVDGVATPVRRSYAHTDPGQRLLTVGSHGNVELAVNRGRGDDAFGVSAGDEVTVVW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	239 (231)
Sequences:	998 (800)
Seq/√Len:	52.7

HALSA - Q9HSC5
SULSO - Q980N6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_T	197_A	5.591	1.00
70_A	76_A	4.498	1.00
46_A	75_V	3.609	1.00
218_V	221_G	3.499	1.00
196_Y	207_T	2.911	1.00
21_P	27_A	2.649	1.00
155_G	168_T	2.547	1.00
58_A	111_F	2.522	1.00
200_D	203_Q	2.466	1.00
22_R	162_G	2.439	1.00
15_D	18_H	2.421	1.00
30_F	209_G	2.387	1.00
2_K	15_D	2.383	1.00
60_V	125_T	2.381	1.00
45_L	115_A	2.375	1.00
155_G	170_L	2.366	1.00
60_V	69_V	2.332	1.00
6_L	13_L	2.316	1.00
57_S	89_D	2.295	1.00
13_L	45_L	2.287	1.00
62_R	86_D	2.269	1.00
57_S	72_D	2.232	1.00
167_I	209_G	2.101	1.00
60_V	128_Q	2.090	1.00
199_T	205_L	2.074	1.00
88_A	125_T	2.036	1.00
28_A	75_V	2.032	1.00
6_L	14_V	2.012	1.00
39_F	44_H	1.969	1.00
87_A	131_E	1.941	1.00
36_V	68_I	1.862	0.99
20_L	31_W	1.834	0.99
199_T	219_N	1.827	0.99
204_R	227_F	1.753	0.99
193_R	198_H	1.742	0.99
21_P	24_D	1.692	0.99
195_S	198_H	1.657	0.98
171_P	174_I	1.647	0.98
26_R	156_T	1.637	0.98
223_G	227_F	1.636	0.98
172_G	208_V	1.622	0.98
23_Q	220_R	1.621	0.98
196_Y	217_A	1.602	0.98
155_G	169_N	1.602	0.98
149_T	152_G	1.592	0.98
67_A	118_I	1.577	0.98
43_V	115_A	1.561	0.98
6_L	12_R	1.558	0.98
201_P	220_R	1.556	0.98
190_T	216_L	1.541	0.98
172_G	212_G	1.484	0.97
114_A	128_Q	1.480	0.97
52_V	106_H	1.473	0.97
24_D	27_A	1.459	0.97
3_G	38_Y	1.459	0.97
28_A	46_A	1.453	0.96
194_R	198_H	1.434	0.96
30_F	211_H	1.401	0.96
47_V	52_V	1.384	0.95
196_Y	215_E	1.383	0.95
41_P	65_S	1.371	0.95
117_D	123_V	1.368	0.95
95_I	117_D	1.359	0.95
62_R	87_A	1.349	0.95
81_R	145_A	1.343	0.94
102_S	106_H	1.340	0.94
53_G	56_R	1.320	0.94
59_V	138_Y	1.316	0.94
49_D	52_V	1.309	0.94
44_H	66_H	1.279	0.93
20_L	28_A	1.278	0.93
61_V	70_A	1.274	0.93
36_V	66_H	1.269	0.93
147_A	154_A	1.268	0.93
222_R	225_D	1.261	0.92
52_V	56_R	1.255	0.92
47_V	56_R	1.251	0.92
190_T	206_L	1.247	0.92
49_D	56_R	1.244	0.92
60_V	88_A	1.237	0.92
89_D	130_P	1.219	0.91
61_V	68_I	1.216	0.91
157_V	222_R	1.207	0.91
39_F	42_A	1.204	0.91
23_Q	196_Y	1.203	0.90
160_V	224_D	1.203	0.90
96_D	114_A	1.191	0.90
216_L	223_G	1.185	0.90
54_T	195_S	1.163	0.89
184_E	187_G	1.150	0.88
29_A	78_P	1.143	0.88
216_L	227_F	1.131	0.88
47_V	106_H	1.119	0.87
49_D	111_F	1.115	0.87
49_D	109_D	1.110	0.87
2_K	39_F	1.110	0.87
2_K	215_E	1.106	0.86
206_L	214_V	1.102	0.86
90_I	96_D	1.101	0.86
24_D	231_A	1.093	0.86
166_A	233_D	1.089	0.85
61_V	76_A	1.062	0.84
43_V	69_V	1.052	0.83
34_E	167_I	1.050	0.83
104_T	210_S	1.041	0.83
193_R	205_L	1.033	0.82
53_G	106_H	1.032	0.82
51_G	56_R	1.028	0.82
16_I	44_H	1.024	0.82
52_V	108_R	1.020	0.81
191_P	203_Q	1.018	0.81
209_G	215_E	1.018	0.81
76_A	80_A	1.013	0.81
50_P	108_R	1.012	0.81
157_V	166_A	1.011	0.81
63_A	66_H	1.008	0.81
56_R	106_H	1.002	0.80
32_L	70_A	0.997	0.80
47_V	51_G	0.994	0.80
30_F	167_I	0.994	0.80
47_V	53_G	0.987	0.79
160_V	166_A	0.987	0.79
60_V	90_I	0.984	0.79
47_V	107_G	0.978	0.79
56_R	108_R	0.958	0.77
172_G	176_A	0.949	0.77
205_L	217_A	0.945	0.76
57_S	132_Y	0.943	0.76
31_W	159_A	0.941	0.76
30_F	196_Y	0.939	0.76
50_P	53_G	0.934	0.75
95_I	128_Q	0.929	0.75
61_V	80_A	0.923	0.75
68_I	83_I	0.921	0.74
50_P	71_P	0.907	0.73
123_V	128_Q	0.898	0.72
53_G	104_T	0.893	0.72
49_D	105_F	0.889	0.72
51_G	108_R	0.886	0.71
92_V	95_I	0.885	0.71
56_R	107_G	0.882	0.71
185_V	235_V	0.881	0.71
58_A	110_V	0.871	0.70
80_A	84_A	0.868	0.70
195_S	199_T	0.863	0.69
47_V	108_R	0.859	0.69
9_T	12_R	0.854	0.69
52_V	107_G	0.851	0.68
2_K	18_H	0.846	0.68
103_A	194_R	0.844	0.68
81_R	140_R	0.835	0.67
52_V	104_T	0.831	0.67
53_G	102_S	0.824	0.66
153_A	169_N	0.821	0.66
94_E	127_D	0.819	0.65
50_P	107_G	0.818	0.65
27_A	31_W	0.816	0.65
53_G	108_R	0.810	0.65
49_D	106_H	0.810	0.65
51_G	54_T	0.803	0.64
5_V	8_T	0.802	0.64
53_G	71_P	0.801	0.64
139_E	142_S	0.795	0.63
167_I	215_E	0.793	0.63
182_T	189_A	0.792	0.63
63_A	83_I	0.788	0.62
92_V	110_V	0.787	0.62
18_H	28_A	0.784	0.62
105_F	108_R	0.783	0.62
52_V	109_D	0.782	0.62
87_A	126_F	0.776	0.61
5_V	115_A	0.775	0.61
52_V	102_S	0.775	0.61
32_L	46_A	0.775	0.61
204_R	218_V	0.774	0.61
111_F	115_A	0.773	0.61
208_V	214_V	0.768	0.60
71_P	107_G	0.763	0.60
8_T	117_D	0.763	0.60
58_A	90_I	0.758	0.59
84_A	87_A	0.753	0.59
56_R	109_D	0.750	0.59
5_V	43_V	0.750	0.59
58_A	69_V	0.749	0.58
56_R	71_P	0.747	0.58
14_V	39_F	0.741	0.58
166_A	229_V	0.737	0.57
56_R	105_F	0.735	0.57
51_G	71_P	0.728	0.56
43_V	183_V	0.728	0.56
124_D	127_D	0.727	0.56
54_T	102_S	0.727	0.56
20_L	44_H	0.727	0.56
49_D	108_R	0.727	0.56
13_L	43_V	0.726	0.56
217_A	229_V	0.723	0.56
43_V	119_H	0.720	0.55
92_V	97_V	0.718	0.55
223_G	229_V	0.718	0.55
8_T	119_H	0.713	0.55
52_V	71_P	0.712	0.55
76_A	118_I	0.707	0.54
207_T	217_A	0.706	0.54
118_I	129_Y	0.704	0.54
102_S	108_R	0.698	0.53
50_P	54_T	0.698	0.53
60_V	129_Y	0.697	0.53
5_V	11_A	0.696	0.53
64_G	157_V	0.694	0.53
117_D	211_H	0.693	0.53
50_P	56_R	0.692	0.53
2_K	14_V	0.689	0.52
54_T	106_H	0.688	0.52
53_G	107_G	0.687	0.52
146_P	169_N	0.686	0.52
9_T	13_L	0.685	0.52
69_V	76_A	0.685	0.52
73_N	109_D	0.681	0.51
165_N	199_T	0.674	0.51
48_V	140_R	0.672	0.50
57_S	137_D	0.670	0.50
4_V	7_Q	0.668	0.50
62_R	126_F	0.666	0.50
218_V	222_R	0.661	0.49
163_F	213_N	0.656	0.49
56_R	102_S	0.655	0.49
168_T	235_V	0.655	0.49
192_V	208_V	0.649	0.48
167_I	207_T	0.646	0.48
27_A	211_H	0.645	0.48
90_I	117_D	0.640	0.47
2_K	165_N	0.637	0.47
201_P	204_R	0.635	0.47
6_L	44_H	0.635	0.47
6_L	192_V	0.634	0.46
230_S	233_D	0.634	0.46
32_L	104_T	0.634	0.46
60_V	118_I	0.632	0.46
43_V	60_V	0.632	0.46
11_A	220_R	0.631	0.46
102_S	210_S	0.630	0.46
5_V	112_A	0.629	0.46
52_V	105_F	0.629	0.46
60_V	67_A	0.626	0.46
51_G	106_H	0.625	0.45
64_G	86_D	0.623	0.45
56_R	111_F	0.622	0.45
146_P	174_I	0.620	0.45
39_F	169_N	0.620	0.45
92_V	96_D	0.618	0.45
206_L	216_L	0.612	0.44
53_G	105_F	0.612	0.44
64_G	84_A	0.611	0.44
31_W	211_H	0.611	0.44
2_K	78_P	0.611	0.44
125_T	129_Y	0.609	0.44
33_R	213_N	0.607	0.44
38_Y	104_T	0.607	0.44
71_P	210_S	0.606	0.44
36_V	39_F	0.605	0.43
187_G	190_T	0.600	0.43
112_A	116_A	0.599	0.43
62_R	67_A	0.599	0.43
172_G	214_V	0.598	0.43
20_L	25_V	0.598	0.43
79_A	83_I	0.598	0.43
25_V	28_A	0.595	0.42
67_A	237_V	0.594	0.42
166_A	204_R	0.592	0.42
47_V	109_D	0.592	0.42
91_D	130_P	0.589	0.42
133_E	137_D	0.589	0.42
4_V	210_S	0.589	0.42
34_E	159_A	0.588	0.42
144_P	183_V	0.583	0.41
114_A	117_D	0.583	0.41
185_V	227_F	0.579	0.41
16_I	40_P	0.576	0.40
49_D	53_G	0.575	0.40
118_I	125_T	0.574	0.40
79_A	82_R	0.574	0.40
36_V	41_P	0.573	0.40
29_A	158_I	0.571	0.40
158_I	215_E	0.571	0.40
51_G	107_G	0.571	0.40
189_A	199_T	0.570	0.40
2_K	6_L	0.570	0.40
199_T	207_T	0.564	0.39
62_R	65_S	0.563	0.39
106_H	110_V	0.561	0.39
4_V	108_R	0.560	0.39
159_A	223_G	0.560	0.39
157_V	193_R	0.560	0.39
47_V	50_P	0.558	0.39
185_V	206_L	0.558	0.39
16_I	210_S	0.556	0.38
50_P	106_H	0.556	0.38
110_V	132_Y	0.556	0.38
128_Q	173_E	0.554	0.38
75_V	223_G	0.553	0.38
41_P	148_V	0.553	0.38
2_K	169_N	0.552	0.38
153_A	170_L	0.552	0.38
117_D	122_G	0.545	0.37
68_I	127_D	0.545	0.37
50_P	104_T	0.541	0.37
38_Y	97_V	0.541	0.37
90_I	111_F	0.538	0.37
52_V	111_F	0.538	0.37
44_H	206_L	0.537	0.37
116_A	210_S	0.535	0.36
3_G	44_H	0.534	0.36
154_A	234_E	0.534	0.36
196_Y	219_N	0.533	0.36
50_P	105_F	0.533	0.36
78_P	158_I	0.532	0.36
36_V	79_A	0.531	0.36
90_I	237_V	0.530	0.36
192_V	214_V	0.530	0.36
165_N	215_E	0.530	0.36
17_A	20_L	0.528	0.36
160_V	231_A	0.526	0.35
39_F	165_N	0.522	0.35
39_F	215_E	0.521	0.35
25_V	141_V	0.521	0.35
126_F	150_D	0.521	0.35
18_H	169_N	0.520	0.35
89_D	132_Y	0.520	0.35
118_I	121_R	0.516	0.35
27_A	196_Y	0.516	0.35
66_H	78_P	0.514	0.34
132_Y	137_D	0.514	0.34
107_G	164_G	0.514	0.34
42_A	129_Y	0.510	0.34
47_V	71_P	0.506	0.34
68_I	125_T	0.505	0.33
23_Q	34_E	0.504	0.33
77_V	83_I	0.504	0.33
108_R	113_P	0.504	0.33
95_I	123_V	0.504	0.33
4_V	51_G	0.504	0.33
133_E	138_Y	0.504	0.33
39_F	66_H	0.502	0.33
159_A	167_I	0.501	0.33
64_G	208_V	0.501	0.33
165_N	212_G	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2q6kA	5	0.9456	100	0.09	Contact Map
2zbvA	3	0.9833	100	0.091	Contact Map
2wr8A	3	0.9707	100	0.095	Contact Map
2cw5A	3	0.9498	100	0.116	Contact Map
2f4nA	4	0.8619	100	0.122	Contact Map
1rqpA	4	0.9874	100	0.127	Contact Map
4c92E	1	0.3054	13.8	0.967	Contact Map
3i18A	1	0.1381	11.3	0.968	Contact Map
3q3wA	1	0.5105	10.4	0.969	Contact Map
1ljoA	3	0.2929	10.3	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0086 seconds.