NADM - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NADM - Nicotinamide-nucleotide adenylyltransferase

UniProt:	Q9HSC4	Sequences: MTRGFYIGRFQPFHTGHRRVIEQIATEVDELVVGIGSAGDSHSARNPFTAGERIMMITKALVEFNLVTYAVPIEDLERNAVWVSHVRSMCPKFEVAYSNNPLVIRLFNEAAVEVRQPPMYDRDVLEGAEIRRRMADGDDWESLVPDAVADVVAEIDGVERIQHVADTDANGHDSGLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	177 (165)
Sequences:	522 (411)
Seq/√Len:	32.0

HALSA - NADM
SULSO - NADM

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
141_E	153_A	6.170	1.00
13_F	57_I	5.560	1.00
13_F	18_R	4.604	1.00
4_G	28_V	4.541	1.00
25_A	67_V	3.276	1.00
156_D	159_E	3.105	1.00
30_E	69_Y	2.841	1.00
55_M	151_V	2.524	1.00
132_R	136_D	2.417	0.99
34_G	73_I	2.308	0.99
139_D	142_S	2.281	0.99
6_Y	20_V	2.186	0.99
104_I	114_V	2.126	0.98
37_S	75_D	2.089	0.98
35_I	70_A	2.017	0.98
23_Q	26_T	1.978	0.97
129_E	133_R	1.892	0.97
3_R	30_E	1.881	0.96
37_S	82_W	1.842	0.96
13_F	21_I	1.790	0.95
36_G	75_D	1.765	0.95
3_R	32_V	1.678	0.93
21_I	31_L	1.628	0.92
48_F	56_M	1.608	0.92
79_N	103_V	1.572	0.91
42_H	102_L	1.549	0.90
11_Q	53_R	1.546	0.90
104_I	108_N	1.526	0.90
61_L	68_T	1.523	0.89
75_D	82_W	1.523	0.89
100_N	103_V	1.491	0.88
129_E	132_R	1.481	0.88
18_R	61_L	1.477	0.88
23_Q	27_E	1.464	0.88
9_R	17_H	1.458	0.87
133_R	143_L	1.432	0.86
4_G	101_P	1.431	0.86
146_D	150_D	1.421	0.86
83_V	102_L	1.420	0.86
54_I	58_T	1.418	0.86
112_V	164_V	1.341	0.82
9_R	14_H	1.332	0.82
20_V	126_E	1.308	0.81
63_E	147_A	1.301	0.80
60_A	147_A	1.239	0.77
28_V	31_L	1.220	0.76
121_D	124_V	1.203	0.75
55_M	59_K	1.200	0.75
48_F	157_G	1.197	0.74
44_A	164_V	1.191	0.74
60_A	148_V	1.178	0.73
22_E	66_L	1.177	0.73
10_F	14_H	1.176	0.73
134_M	161_I	1.160	0.72
75_D	102_L	1.156	0.72
152_V	157_G	1.154	0.72
38_A	50_A	1.146	0.71
14_H	17_H	1.139	0.71
56_M	148_V	1.126	0.70
22_E	64_F	1.105	0.68
25_A	66_L	1.099	0.68
49_T	52_E	1.042	0.64
12_P	16_G	1.034	0.63
50_A	73_I	1.030	0.63
7_I	75_D	1.028	0.63
159_E	162_Q	1.024	0.62
8_G	14_H	1.021	0.62
140_W	149_A	1.017	0.62
32_V	155_I	1.016	0.62
42_H	109_E	1.015	0.62
59_K	150_D	1.009	0.61
150_D	154_E	1.007	0.61
8_G	17_H	1.004	0.61
42_H	52_E	1.003	0.61
29_D	71_V	1.002	0.61
4_G	31_L	1.001	0.61
83_V	87_R	0.996	0.60
163_H	166_D	0.983	0.59
51_G	91_P	0.980	0.59
56_M	152_V	0.980	0.59
134_M	158_V	0.968	0.58
74_E	85_H	0.961	0.57
76_L	85_H	0.958	0.57
140_W	144_V	0.955	0.57
140_W	162_Q	0.943	0.56
33_V	57_I	0.935	0.55
12_P	17_H	0.934	0.55
41_S	75_D	0.914	0.54
104_I	164_V	0.908	0.53
141_E	146_D	0.900	0.52
5_F	34_G	0.898	0.52
56_M	151_V	0.896	0.52
68_T	95_V	0.893	0.52
87_R	119_M	0.891	0.52
22_E	26_T	0.885	0.51
21_I	121_D	0.878	0.51
15_T	31_L	0.874	0.50
136_D	139_D	0.873	0.50
99_N	103_V	0.869	0.50
149_A	153_A	0.869	0.50
10_F	17_H	0.865	0.50
27_E	115_R	0.857	0.49
35_I	50_A	0.854	0.49
67_V	108_N	0.853	0.49
138_D	142_S	0.853	0.49
48_F	60_A	0.852	0.49
90_C	120_Y	0.838	0.47
149_A	156_D	0.836	0.47
81_V	128_A	0.833	0.47
32_V	164_V	0.832	0.47
67_V	70_A	0.819	0.46
157_G	160_R	0.818	0.46
27_E	162_Q	0.815	0.45
26_T	66_L	0.813	0.45
6_Y	117_P	0.813	0.45
33_V	68_T	0.806	0.45
4_G	103_V	0.805	0.45
73_I	89_M	0.802	0.44
25_A	78_R	0.794	0.44
69_Y	79_N	0.792	0.44
21_I	33_V	0.789	0.43
31_L	110_A	0.788	0.43
6_Y	21_I	0.786	0.43
77_E	117_P	0.786	0.43
39_G	74_E	0.779	0.43
25_A	70_A	0.779	0.43
68_T	130_I	0.772	0.42
34_G	71_V	0.766	0.42
7_I	82_W	0.765	0.41
10_F	46_N	0.763	0.41
64_F	80_A	0.758	0.41
25_A	82_W	0.756	0.41
22_E	63_E	0.756	0.41
66_L	130_I	0.755	0.41
24_I	90_C	0.753	0.41
96_A	107_F	0.751	0.40
18_R	22_E	0.748	0.40
52_E	145_P	0.742	0.40
18_R	66_L	0.736	0.39
90_C	163_H	0.734	0.39
73_I	123_D	0.733	0.39
50_A	72_P	0.733	0.39
144_V	148_V	0.729	0.39
9_R	16_G	0.725	0.38
29_D	140_W	0.723	0.38
22_E	67_V	0.722	0.38
65_N	142_S	0.719	0.38
48_F	148_V	0.717	0.38
43_S	59_K	0.715	0.38
42_H	75_D	0.710	0.37
70_A	108_N	0.708	0.37
60_A	145_P	0.706	0.37
57_I	84_S	0.699	0.36
43_S	75_D	0.696	0.36
159_E	165_A	0.692	0.36
87_R	112_V	0.686	0.35
154_E	157_G	0.684	0.35
104_I	120_Y	0.680	0.35
162_Q	166_D	0.679	0.35
152_V	158_V	0.679	0.35
60_A	73_I	0.679	0.35
66_L	125_L	0.675	0.35
105_R	163_H	0.673	0.34
108_N	132_R	0.672	0.34
108_N	111_A	0.668	0.34
15_T	95_V	0.666	0.34
64_F	70_A	0.663	0.34
7_I	36_G	0.663	0.34
16_G	36_G	0.655	0.33
94_E	100_N	0.655	0.33
83_V	112_V	0.654	0.33
55_M	152_V	0.653	0.33
30_E	51_G	0.651	0.33
60_A	153_A	0.648	0.33
22_E	31_L	0.647	0.32
91_P	160_R	0.643	0.32
4_G	44_A	0.642	0.32
15_T	145_P	0.642	0.32
109_E	140_W	0.638	0.32
133_R	138_D	0.635	0.32
58_T	66_L	0.630	0.31
83_V	107_F	0.627	0.31
41_S	78_R	0.625	0.31
11_Q	17_H	0.624	0.31
87_R	116_Q	0.624	0.31
42_H	107_F	0.619	0.30
77_E	126_E	0.617	0.30
26_T	64_F	0.616	0.30
110_A	114_V	0.611	0.30
3_R	127_G	0.610	0.30
3_R	103_V	0.608	0.30
119_M	127_G	0.608	0.30
125_L	143_L	0.605	0.30
107_F	111_A	0.601	0.29
104_I	113_E	0.599	0.29
82_W	127_G	0.598	0.29
4_G	97_Y	0.598	0.29
13_F	60_A	0.596	0.29
42_H	101_P	0.594	0.29
91_P	94_E	0.591	0.29
136_D	153_A	0.589	0.28
134_M	155_I	0.587	0.28
40_D	43_S	0.585	0.28
41_S	102_L	0.584	0.28
40_D	46_N	0.584	0.28
135_A	165_A	0.581	0.28
156_D	161_I	0.579	0.28
86_V	98_S	0.579	0.28
30_E	54_I	0.579	0.28
87_R	110_A	0.578	0.28
35_I	150_D	0.574	0.27
11_Q	14_H	0.572	0.27
7_I	37_S	0.572	0.27
95_V	115_R	0.568	0.27
25_A	104_I	0.564	0.27
46_N	131_R	0.564	0.27
3_R	100_N	0.562	0.27
33_V	81_V	0.562	0.27
148_V	151_V	0.558	0.26
45_R	87_R	0.557	0.26
65_N	116_Q	0.556	0.26
67_V	77_E	0.555	0.26
48_F	112_V	0.554	0.26
36_G	73_I	0.550	0.26
36_G	43_S	0.550	0.26
135_A	161_I	0.548	0.26
108_N	113_E	0.547	0.26
49_T	145_P	0.545	0.26
42_H	91_P	0.543	0.25
16_G	70_A	0.542	0.25
137_G	158_V	0.540	0.25
110_A	113_E	0.538	0.25
10_F	13_F	0.535	0.25
49_T	122_R	0.533	0.25
76_L	87_R	0.531	0.25
153_A	158_V	0.528	0.25
35_I	66_L	0.528	0.25
77_E	108_N	0.527	0.24
29_D	142_S	0.520	0.24
102_L	119_M	0.518	0.24
108_N	117_P	0.518	0.24
19_R	166_D	0.516	0.24
107_F	114_V	0.513	0.24
7_I	34_G	0.510	0.23
54_I	77_E	0.510	0.23
39_G	144_V	0.507	0.23
100_N	160_R	0.506	0.23
15_T	59_K	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ej2A	5	0.9209	100	0.524	Contact Map
1f9aA	5	0.9266	100	0.531	Contact Map
2qjtB	2	1	100	0.553	Contact Map
2qjoA	3	0.9887	100	0.565	Contact Map
3nv7A	4	0.8192	99.9	0.651	Contact Map
4natA	5	0.8136	99.9	0.652	Contact Map
4f3rA	5	0.774	99.8	0.653	Contact Map
1qjcA	4	0.8249	99.8	0.655	Contact Map
3nd5A	5	0.791	99.8	0.655	Contact Map
1o6bA	5	0.8588	99.8	0.656	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.