Q9HSB0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HSB0 - Uncharacterized protein

UniProt:	Q9HSB0	Sequences: MSATTAASRTLTPKQHRILSYLQDHADERTYFKSRLIGDELDLSAKEVGANMPAIEDADHDLDVERWGYSSSTTWKVASA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	80 (72)
Sequences:	142 (83)
Seq/√Len:	9.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_A	72_S	2.451	0.82
41_L	70_S	2.311	0.78
12_T	20_S	2.222	0.75
16_H	78_A	1.861	0.60
63_D	78_A	1.808	0.58
13_P	78_A	1.786	0.57
35_R	76_K	1.612	0.49
7_A	55_I	1.606	0.49
33_K	69_Y	1.592	0.48
55_I	64_V	1.478	0.43
48_V	51_N	1.458	0.42
12_T	21_Y	1.450	0.42
61_D	77_V	1.445	0.42
57_D	63_D	1.436	0.41
35_R	68_G	1.436	0.41
52_M	71_S	1.433	0.41
14_K	47_E	1.416	0.40
23_Q	61_D	1.396	0.40
20_S	57_D	1.393	0.39
47_E	71_S	1.376	0.39
51_N	70_S	1.336	0.37
17_R	66_R	1.325	0.37
17_R	39_D	1.311	0.36
18_I	48_V	1.254	0.34
48_V	70_S	1.245	0.33
15_Q	58_A	1.210	0.32
66_R	71_S	1.208	0.32
32_F	37_I	1.185	0.31
44_S	61_D	1.179	0.31
30_T	71_S	1.158	0.30
10_T	39_D	1.137	0.29
23_Q	62_L	1.135	0.29
9_R	42_D	1.113	0.28
8_S	27_D	1.108	0.28
33_K	47_E	1.103	0.28
52_M	57_D	1.099	0.28
38_G	50_A	1.097	0.28
62_L	76_K	1.065	0.26
33_K	51_N	1.053	0.26
38_G	72_S	1.052	0.26
15_Q	51_N	1.041	0.26
9_R	39_D	1.034	0.25
41_L	48_V	1.015	0.25
34_S	40_E	1.014	0.25
43_L	57_D	1.012	0.25
20_S	27_D	1.001	0.24
52_M	64_V	0.997	0.24
32_F	42_D	0.985	0.24
42_D	72_S	0.973	0.23
41_L	58_A	0.968	0.23
20_S	63_D	0.965	0.23
39_D	59_D	0.954	0.23
47_E	51_N	0.946	0.22
36_L	68_G	0.945	0.22
15_Q	54_A	0.942	0.22
31_Y	67_W	0.940	0.22
8_S	16_H	0.913	0.21
68_G	76_K	0.906	0.21
48_V	72_S	0.889	0.21
9_R	20_S	0.880	0.20
33_K	40_E	0.878	0.20
13_P	16_H	0.862	0.20
41_L	51_N	0.844	0.19
15_Q	47_E	0.840	0.19
17_R	58_A	0.812	0.18
14_K	61_D	0.812	0.18
8_S	13_P	0.806	0.18
8_S	20_S	0.767	0.17
11_L	30_T	0.761	0.17
27_D	77_V	0.754	0.17
38_G	64_V	0.744	0.17
36_L	51_N	0.740	0.17
22_L	32_F	0.733	0.16
59_D	64_V	0.729	0.16
21_Y	63_D	0.711	0.16
21_Y	77_V	0.710	0.16
47_E	69_Y	0.707	0.16
14_K	33_K	0.699	0.16
51_N	69_Y	0.696	0.16
27_D	78_A	0.683	0.15
10_T	66_R	0.683	0.15
40_E	69_Y	0.682	0.15
36_L	70_S	0.680	0.15
26_A	61_D	0.675	0.15
18_I	72_S	0.670	0.15
9_R	78_A	0.668	0.15
14_K	69_Y	0.661	0.15
11_L	35_R	0.655	0.15
7_A	42_D	0.651	0.14
34_S	62_L	0.650	0.14
37_I	46_K	0.648	0.14
36_L	48_V	0.646	0.14
56_E	61_D	0.623	0.14
18_I	51_N	0.619	0.14
17_R	43_L	0.610	0.14
13_P	26_A	0.608	0.14
30_T	41_L	0.595	0.13
11_L	48_V	0.593	0.13
9_R	27_D	0.584	0.13
40_E	76_K	0.575	0.13
10_T	62_L	0.565	0.13
12_T	19_L	0.563	0.13
33_K	52_M	0.563	0.13
36_L	71_S	0.541	0.12
10_T	43_L	0.530	0.12
44_S	63_D	0.509	0.12
35_R	47_E	0.503	0.11
13_P	63_D	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3eyiA	1	0.775	90.3	0.855	Contact Map
1qgpA	1	0.9125	88.2	0.86	Contact Map
1qbjA	1	0.8125	85.8	0.865	Contact Map
4ou0A	1	0.8125	82.4	0.871	Contact Map
1oyiA	1	0.775	79.4	0.875	Contact Map
2lnbA	1	0.8875	76.5	0.878	Contact Map
1xmkA	1	0.8375	68.9	0.885	Contact Map
4ch7A	1	0.825	68.8	0.885	Contact Map
2pn6A	5	0.825	67	0.886	Contact Map
3lmmA	1	0.9	66.1	0.887	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.