Q9HS98 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS98 - Purine phosphoribosyltransferase

UniProt:	Q9HS98	Sequences: MSDLPDDFNCTITNWEYIYGLCRDVSDQVKAADFEPDVVVALARGGWFAGRCLCDFLGLNDLTSLKMEHYVGTAEKSAEPEVRYPMPEGSVEDKDVLIIDDIADTGGSIEHAHEYVQDRDANAVRTATLQLLQTSAFEPDYVGERLDEWAWIVYPWNFIEDMIDIIAGVMATDDDGPYTTAGIRDLLADYHDVDRIQMEIAQPDRLTEVRSEMVRRDVLAATDADRWALV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	230 (173)
Sequences:	292 (190)
Seq/√Len:	14.5

ECOLI - HPRT XGPT
BACSU - HPRT
HALSA - Q9HS98
SULSO - Q97W95 Q97W22

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_A	141_Y	4.003	1.00
18_I	129_L	3.199	0.98
26_S	116_V	2.772	0.96
132_L	157_N	2.643	0.95
125_R	140_D	2.629	0.95
95_D	122_N	2.525	0.93
102_I	128_T	2.400	0.91
108_S	128_T	2.371	0.91
39_V	54_C	2.217	0.88
95_D	123_A	2.216	0.88
171_A	175_D	2.184	0.87
108_S	157_N	2.171	0.87
151_W	156_W	2.137	0.86
98_I	105_T	2.107	0.85
103_A	131_L	2.067	0.84
158_F	165_I	2.047	0.83
68_E	160_E	2.035	0.83
57_L	98_I	2.028	0.82
102_I	130_Q	1.886	0.78
133_Q	145_R	1.886	0.78
46_G	155_P	1.788	0.74
71_V	75_E	1.713	0.70
52_C	154_Y	1.697	0.69
37_D	97_L	1.689	0.69
14_N	17_Y	1.681	0.69
28_Q	143_G	1.678	0.69
53_L	65_L	1.663	0.68
19_Y	154_Y	1.643	0.67
61_D	84_Y	1.634	0.66
99_I	108_S	1.611	0.65
153_V	158_F	1.599	0.65
21_L	132_L	1.584	0.64
29_V	53_L	1.547	0.62
98_I	164_D	1.536	0.61
25_V	108_S	1.533	0.61
138_E	153_V	1.520	0.61
69_H	161_D	1.513	0.60
98_I	116_V	1.503	0.60
117_Q	120_D	1.502	0.60
98_I	109_I	1.501	0.60
77_S	102_I	1.493	0.59
42_L	62_L	1.492	0.59
98_I	120_D	1.485	0.59
47_W	108_S	1.459	0.57
94_K	121_A	1.403	0.54
50_G	54_C	1.379	0.53
102_I	152_I	1.368	0.52
113_H	117_Q	1.368	0.52
101_D	106_G	1.346	0.51
98_I	143_G	1.342	0.51
151_W	155_P	1.339	0.51
130_Q	154_Y	1.335	0.51
14_N	122_N	1.331	0.50
39_V	50_G	1.322	0.50
107_G	111_H	1.320	0.50
75_E	78_A	1.287	0.48
172_T	175_D	1.277	0.47
50_G	70_Y	1.261	0.46
66_K	135_S	1.259	0.46
39_V	112_A	1.258	0.46
131_L	139_P	1.250	0.46
128_T	164_D	1.241	0.45
46_G	55_D	1.233	0.45
80_P	115_Y	1.225	0.44
20_G	24_D	1.187	0.42
129_L	168_G	1.177	0.42
29_V	42_L	1.175	0.42
15_W	19_Y	1.171	0.42
108_S	132_L	1.170	0.42
43_A	64_S	1.166	0.41
26_S	122_N	1.147	0.40
106_G	127_A	1.144	0.40
73_T	157_N	1.134	0.40
15_W	155_P	1.126	0.39
92_E	120_D	1.118	0.39
18_I	153_V	1.117	0.39
26_S	93_D	1.111	0.38
47_W	54_C	1.106	0.38
53_L	99_I	1.105	0.38
40_V	98_I	1.103	0.38
23_R	82_V	1.100	0.38
22_C	69_H	1.080	0.37
47_W	91_V	1.079	0.37
38_V	91_V	1.053	0.35
13_T	70_Y	1.053	0.35
89_G	98_I	1.052	0.35
40_V	91_V	1.045	0.35
54_C	62_L	1.036	0.35
70_Y	80_P	1.034	0.34
102_I	157_N	1.024	0.34
79_E	98_I	1.018	0.34
51_R	55_D	0.990	0.32
41_A	60_N	0.988	0.32
141_Y	166_I	0.969	0.31
28_Q	142_V	0.964	0.31
92_E	113_H	0.957	0.31
130_Q	157_N	0.953	0.31
100_D	151_W	0.948	0.30
43_A	65_L	0.940	0.30
42_L	64_S	0.938	0.30
67_M	107_G	0.935	0.30
32_A	125_R	0.921	0.29
130_Q	165_I	0.913	0.29
93_D	141_Y	0.909	0.29
46_G	95_D	0.906	0.28
4_L	175_D	0.903	0.28
50_G	149_W	0.896	0.28
132_L	152_I	0.895	0.28
92_E	138_E	0.887	0.28
110_E	124_V	0.882	0.27
20_G	105_T	0.877	0.27
55_D	149_W	0.875	0.27
153_V	164_D	0.873	0.27
61_D	94_K	0.869	0.27
139_P	155_P	0.861	0.26
69_H	156_W	0.861	0.26
171_A	176_G	0.857	0.26
120_D	136_A	0.856	0.26
99_I	111_H	0.856	0.26
113_H	137_F	0.848	0.26
14_N	38_V	0.846	0.26
44_R	149_W	0.843	0.26
36_P	65_L	0.837	0.25
73_T	108_S	0.836	0.25
64_S	154_Y	0.832	0.25
100_D	168_G	0.831	0.25
102_I	132_L	0.829	0.25
103_A	117_Q	0.829	0.25
12_I	26_S	0.821	0.25
109_I	128_T	0.817	0.25
41_A	85_P	0.817	0.25
157_N	163_I	0.814	0.24
45_G	70_Y	0.813	0.24
151_W	168_G	0.811	0.24
66_K	84_Y	0.810	0.24
110_E	118_D	0.808	0.24
17_Y	50_G	0.800	0.24
58_G	163_I	0.795	0.24
95_D	141_Y	0.794	0.24
150_A	177_P	0.792	0.24
60_N	82_V	0.791	0.24
87_P	99_I	0.789	0.23
13_T	130_Q	0.784	0.23
41_A	129_L	0.780	0.23
56_F	121_A	0.779	0.23
34_F	141_Y	0.765	0.23
76_K	143_G	0.762	0.22
67_M	117_Q	0.758	0.22
35_E	137_F	0.757	0.22
69_H	149_W	0.757	0.22
163_I	169_V	0.755	0.22
107_G	171_A	0.754	0.22
19_Y	56_F	0.748	0.22
104_D	123_A	0.741	0.22
109_I	153_V	0.740	0.22
99_I	109_I	0.739	0.22
25_V	154_Y	0.739	0.22
107_G	119_R	0.735	0.21
138_E	142_V	0.727	0.21
73_T	165_I	0.727	0.21
73_T	128_T	0.725	0.21
99_I	112_A	0.722	0.21
78_A	141_Y	0.721	0.21
78_A	117_Q	0.718	0.21
157_N	165_I	0.718	0.21
129_L	143_G	0.718	0.21
18_I	165_I	0.716	0.21
71_V	173_D	0.712	0.21
73_T	164_D	0.710	0.20
67_M	99_I	0.707	0.20
27_D	108_S	0.705	0.20
89_G	107_G	0.697	0.20
102_I	150_A	0.683	0.20
110_E	125_R	0.683	0.20
89_G	109_I	0.678	0.19
157_N	164_D	0.677	0.19
125_R	174_D	0.675	0.19
170_M	178_Y	0.674	0.19
64_S	151_W	0.674	0.19
116_V	132_L	0.671	0.19
87_P	174_D	0.671	0.19
46_G	139_P	0.670	0.19
93_D	171_A	0.668	0.19
27_D	60_N	0.665	0.19
53_L	78_A	0.661	0.19
44_R	156_W	0.660	0.19
34_F	40_V	0.660	0.19
58_G	126_T	0.659	0.19
69_H	76_K	0.658	0.19
64_S	69_H	0.657	0.19
9_N	125_R	0.653	0.19
29_V	40_V	0.649	0.18
80_P	107_G	0.648	0.18
158_F	162_M	0.646	0.18
102_I	146_L	0.645	0.18
78_A	122_N	0.642	0.18
51_R	151_W	0.637	0.18
4_L	172_T	0.632	0.18
147_D	158_F	0.632	0.18
38_V	96_V	0.629	0.18
151_W	157_N	0.625	0.18
92_E	119_R	0.623	0.18
41_A	154_Y	0.617	0.17
21_L	70_Y	0.613	0.17
13_T	152_I	0.612	0.17
116_V	124_V	0.611	0.17
63_T	70_Y	0.610	0.17
100_D	162_M	0.601	0.17
70_Y	132_L	0.595	0.17
9_N	154_Y	0.591	0.17
40_V	47_W	0.591	0.17
48_F	52_C	0.590	0.16
51_R	172_T	0.590	0.16
55_D	161_D	0.587	0.16
22_C	34_F	0.585	0.16
28_Q	168_G	0.584	0.16
5_P	141_Y	0.579	0.16
124_V	138_E	0.575	0.16
18_I	169_V	0.574	0.16
34_F	121_A	0.574	0.16
42_L	132_L	0.574	0.16
41_A	112_A	0.573	0.16
130_Q	141_Y	0.573	0.16
131_L	145_R	0.573	0.16
47_W	52_C	0.571	0.16
114_E	177_P	0.571	0.16
114_E	146_L	0.569	0.16
101_D	104_D	0.567	0.16
43_A	63_T	0.566	0.16
32_A	152_I	0.563	0.16
51_R	149_W	0.562	0.16
128_T	154_Y	0.558	0.16
27_D	82_V	0.555	0.15
82_V	174_D	0.555	0.15
163_I	167_A	0.551	0.15
12_I	146_L	0.550	0.15
39_V	127_A	0.550	0.15
24_D	92_E	0.550	0.15
40_V	121_A	0.550	0.15
38_V	65_L	0.548	0.15
77_S	123_A	0.542	0.15
70_Y	105_T	0.537	0.15
42_L	154_Y	0.535	0.15
121_A	166_I	0.534	0.15
17_Y	102_I	0.533	0.15
52_C	151_W	0.532	0.15
66_K	73_T	0.531	0.15
103_A	109_I	0.530	0.15
48_F	105_T	0.529	0.15
13_T	132_L	0.520	0.14
21_L	145_R	0.520	0.14
153_V	162_M	0.518	0.14
121_A	124_V	0.513	0.14
13_T	168_G	0.511	0.14
153_V	157_N	0.510	0.14
8_F	172_T	0.509	0.14
101_D	108_S	0.508	0.14
29_V	93_D	0.507	0.14
31_A	141_Y	0.503	0.14
151_W	158_F	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4trbA	2	0.9	100	0.477	Contact Map
5bqpA	3	0.7435	100	0.531	Contact Map
3ozfA	4	0.7783	100	0.554	Contact Map
4qyiA	3	0.7217	100	0.557	Contact Map
1fsgA	4	0.7739	100	0.56	Contact Map
4qriA	2	0.6739	100	0.563	Contact Map
2jbhA	4	0.7739	100	0.565	Contact Map
4raoA	4	0.7478	100	0.565	Contact Map
4rqaA	3	0.7261	100	0.572	Contact Map
2gebA	3	0.7565	100	0.575	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.