Q9HS77 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS77 - Uncharacterized protein

UniProt:	Q9HS77	Sequences: MDDSDPDPPIEQSLGDALRDAGHTVATAESCTGGLIGSLLTDVPGASAYFDRSYVTYSYDAKLDHGVSREHLDEHGAVSEPVARQMARGVRDQAGTTWGIATTGIAGPDGGTPEKPVGTAYIGVAYAGDWGTATSATTVVRREFDGDRQAVKAQIARAALTVLAAELEKVT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (151)
Sequences:	4579 (3486)
Seq/√Len:	283.7

ECOLI - PNCC YDEJ CINAL
BACSU - CINA
HALSA - Q9HS77

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_G	49_Y	2.689	1.00
83_A	103_T	2.674	1.00
23_H	98_W	2.667	1.00
68_S	85_Q	2.532	1.00
63_L	69_R	2.376	1.00
71_H	85_Q	2.348	1.00
36_I	102_T	2.273	1.00
19_R	48_A	2.238	1.00
26_A	96_T	2.120	1.00
71_H	82_V	2.041	1.00
69_R	73_D	1.971	1.00
75_H	81_P	1.928	1.00
80_E	84_R	1.924	1.00
33_G	41_T	1.909	1.00
121_Y	141_R	1.893	1.00
38_S	42_D	1.841	1.00
91_R	125_A	1.818	1.00
35_L	156_A	1.772	1.00
37_G	50_F	1.713	1.00
39_L	156_A	1.707	1.00
23_H	97_T	1.654	1.00
52_R	64_D	1.616	1.00
52_R	94_A	1.610	1.00
121_Y	139_V	1.583	1.00
84_R	139_V	1.564	1.00
124_V	162_V	1.507	1.00
35_L	38_S	1.488	1.00
72_L	77_A	1.475	1.00
56_T	86_M	1.473	1.00
38_S	152_K	1.468	1.00
90_V	99_G	1.461	1.00
161_T	165_A	1.459	1.00
80_E	121_Y	1.458	1.00
68_S	71_H	1.438	1.00
37_G	55_V	1.436	1.00
111_G	114_E	1.432	1.00
84_R	88_R	1.427	1.00
52_R	61_A	1.426	1.00
59_Y	77_A	1.408	1.00
42_D	152_K	1.408	1.00
28_A	65_H	1.400	1.00
44_P	109_D	1.376	1.00
88_R	137_T	1.362	1.00
24_T	51_D	1.352	1.00
27_T	36_I	1.327	1.00
91_R	127_A	1.322	1.00
147_D	150_A	1.305	1.00
36_I	159_A	1.293	1.00
98_W	126_Y	1.293	1.00
11_E	39_L	1.288	1.00
105_I	115_K	1.278	1.00
17_A	164_A	1.270	1.00
28_A	90_V	1.259	1.00
51_D	60_D	1.238	1.00
87_A	125_A	1.227	1.00
25_V	40_L	1.220	1.00
35_L	152_K	1.206	1.00
15_G	43_V	1.205	1.00
64_D	95_G	1.201	1.00
13_S	164_A	1.195	1.00
122_I	142_R	1.168	1.00
40_L	50_F	1.167	1.00
70_E	74_E	1.150	1.00
56_T	61_A	1.142	1.00
17_A	21_A	1.140	1.00
142_R	158_A	1.133	1.00
97_T	127_A	1.117	1.00
161_T	164_A	1.113	1.00
54_Y	94_A	1.101	1.00
61_A	94_A	1.094	1.00
18_L	23_H	1.093	1.00
119_T	141_R	1.090	1.00
158_A	161_T	1.083	1.00
54_Y	90_V	1.078	1.00
75_H	79_S	1.075	1.00
41_T	50_F	1.075	1.00
51_D	96_T	1.071	1.00
27_T	50_F	1.069	1.00
98_W	163_L	1.060	1.00
138_T	166_E	1.058	1.00
124_V	166_E	1.058	1.00
66_G	93_Q	1.049	1.00
125_A	137_T	1.048	1.00
26_A	90_V	1.045	1.00
105_I	110_G	1.034	1.00
12_Q	16_D	1.018	1.00
102_T	155_I	1.012	1.00
24_T	97_T	1.008	1.00
38_S	156_A	0.994	1.00
25_V	163_L	0.989	1.00
84_R	137_T	0.985	1.00
17_A	20_D	0.981	1.00
146_G	151_V	0.979	1.00
14_L	164_A	0.979	1.00
27_T	53_S	0.971	1.00
15_G	40_L	0.958	1.00
14_L	163_L	0.956	1.00
37_G	53_S	0.940	1.00
122_I	158_A	0.937	1.00
101_A	123_G	0.932	1.00
9_P	12_Q	0.923	1.00
126_Y	129_D	0.923	1.00
16_D	19_R	0.919	1.00
67_V	89_G	0.914	1.00
119_T	143_E	0.906	1.00
27_T	37_G	0.903	1.00
102_T	159_A	0.899	1.00
120_A	155_I	0.880	1.00
91_R	99_G	0.880	1.00
76_G	115_K	0.879	1.00
140_V	162_V	0.879	1.00
51_D	58_S	0.865	1.00
139_V	144_F	0.861	1.00
14_L	160_L	0.855	1.00
87_A	123_G	0.853	1.00
149_Q	152_K	0.838	1.00
140_V	158_A	0.832	1.00
150_A	154_Q	0.822	1.00
100_I	163_L	0.821	1.00
15_G	19_R	0.819	1.00
100_I	159_A	0.818	1.00
60_D	64_D	0.813	0.99
115_K	119_T	0.813	0.99
144_F	158_A	0.809	0.99
48_A	109_D	0.809	0.99
11_E	43_V	0.807	0.99
146_G	150_A	0.805	0.99
41_T	46_A	0.802	0.99
26_A	94_A	0.798	0.99
63_L	72_L	0.795	0.99
11_E	42_D	0.794	0.99
35_L	39_L	0.793	0.99
42_D	149_Q	0.792	0.99
31_C	102_T	0.787	0.99
27_T	100_I	0.777	0.99
36_I	156_A	0.772	0.99
31_C	120_A	0.771	0.99
110_G	116_P	0.770	0.99
162_V	166_E	0.764	0.99
15_G	46_A	0.764	0.99
41_T	152_K	0.757	0.99
88_R	125_A	0.753	0.99
39_L	42_D	0.748	0.99
91_R	126_Y	0.743	0.99
65_H	86_M	0.738	0.99
117_V	151_V	0.738	0.99
67_V	82_V	0.737	0.99
71_H	81_P	0.736	0.99
90_V	94_A	0.735	0.99
23_H	126_Y	0.730	0.99
54_Y	93_Q	0.729	0.99
126_Y	166_E	0.712	0.99
10_I	164_A	0.711	0.99
120_A	151_V	0.708	0.99
16_D	20_D	0.704	0.99
105_I	111_G	0.703	0.99
11_E	15_G	0.699	0.98
67_V	71_H	0.686	0.98
158_A	162_V	0.684	0.98
88_R	92_D	0.679	0.98
64_D	93_Q	0.674	0.98
151_V	155_I	0.673	0.98
18_L	98_W	0.670	0.98
111_G	117_V	0.667	0.98
149_Q	153_A	0.663	0.98
45_G	148_R	0.663	0.98
39_L	157_R	0.655	0.98
146_G	154_Q	0.653	0.98
88_R	91_R	0.653	0.98
15_G	18_L	0.653	0.98
18_L	25_V	0.651	0.98
59_Y	76_G	0.644	0.97
59_Y	111_G	0.637	0.97
54_Y	65_H	0.636	0.97
145_D	154_Q	0.626	0.97
87_A	99_G	0.625	0.97
13_S	16_D	0.624	0.97
39_L	153_A	0.623	0.97
24_T	96_T	0.621	0.97
80_E	141_R	0.614	0.97
79_S	82_V	0.614	0.97
109_D	117_V	0.610	0.96
71_H	75_H	0.609	0.96
19_R	49_Y	0.608	0.96
80_E	139_V	0.607	0.96
58_S	76_G	0.607	0.96
31_C	111_G	0.606	0.96
46_A	49_Y	0.599	0.96
154_Q	161_T	0.593	0.96
13_S	17_A	0.593	0.96
153_A	157_R	0.592	0.96
111_G	119_T	0.590	0.96
122_I	159_A	0.584	0.95
54_Y	61_A	0.574	0.95
162_V	165_A	0.569	0.95
154_Q	157_R	0.567	0.95
110_G	114_E	0.563	0.94
27_T	40_L	0.560	0.94
71_H	79_S	0.560	0.94
36_I	40_L	0.560	0.94
123_G	139_V	0.555	0.94
77_A	115_K	0.554	0.94
110_G	117_V	0.554	0.94
86_M	101_A	0.549	0.94
72_L	82_V	0.549	0.94
85_Q	89_G	0.547	0.94
110_G	113_P	0.543	0.93
10_I	14_L	0.542	0.93
138_T	165_A	0.542	0.93
76_G	105_I	0.539	0.93
83_A	101_A	0.537	0.93
98_W	127_A	0.533	0.93
35_L	149_Q	0.533	0.93
38_S	149_Q	0.531	0.93
157_R	161_T	0.531	0.93
81_P	85_Q	0.531	0.93
66_G	92_D	0.520	0.92
36_I	160_L	0.519	0.92
144_F	154_Q	0.515	0.91
87_A	139_V	0.510	0.91
105_I	116_P	0.508	0.91
36_I	155_I	0.507	0.91
56_T	65_H	0.506	0.91
148_R	152_K	0.504	0.90
31_C	155_I	0.502	0.90
87_A	91_R	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2a9sA	2	0.9591	100	0.122	Contact Map
4uuwA	2	0.9064	100	0.171	Contact Map
3wvaA	2	0.807	96.9	0.866	Contact Map
4a37A	1	0.4971	13.2	0.949	Contact Map
1z5rA	1	0.5205	12.6	0.949	Contact Map
2c1cA	1	0.5439	11.9	0.95	Contact Map
2a1jA	1	0.3567	10.7	0.951	Contact Map
3zdoA	3	0.2222	10.3	0.951	Contact Map
1kwmA	1	0.5263	9.8	0.952	Contact Map
2phnA	2	0.8772	9.7	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.