Q9HS73 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS73 - Transcription elongation factor Spt5

UniProt:	Q9HS73	Sequences: MSVFAVKTTASQEQTVASMIANREEDTIHAVLAPDALTSYVMVEAEDTAAIERTMDEIPHARSLVPGESGISEVEHFLSPKPDVEGIAENDIVELIAGPFKGEKAQVQRIDEGKDQVTVELYEATVPIPVTVRGDQIRVLDSEER	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (127)
Sequences:	470 (295)
Seq/√Len:	26.1

HALSA - Q9HS73
SULSO - SPT5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_D	54_T	3.856	1.00
40_Y	118_T	2.600	0.99
48_T	52_E	2.511	0.99
20_I	41_V	2.458	0.99
55_M	61_A	2.446	0.99
12_Q	15_T	2.331	0.98
103_E	124_A	2.325	0.98
3_V	77_F	2.238	0.98
83_D	119_V	2.142	0.97
16_V	60_H	2.112	0.97
103_E	126_V	2.083	0.96
3_V	74_V	2.015	0.96
43_V	61_A	1.889	0.94
94_E	123_E	1.878	0.94
20_I	23_R	1.860	0.93
106_Q	120_E	1.823	0.93
42_M	69_S	1.808	0.92
93_V	105_A	1.776	0.92
94_E	124_A	1.694	0.90
94_E	100_F	1.686	0.89
98_G	102_G	1.678	0.89
28_I	54_T	1.672	0.89
17_A	31_V	1.640	0.88
95_L	98_G	1.608	0.87
94_E	104_K	1.586	0.86
103_E	123_E	1.566	0.85
100_F	103_E	1.556	0.85
3_V	75_E	1.487	0.82
23_R	28_I	1.438	0.80
94_E	103_E	1.382	0.77
54_T	57_E	1.378	0.77
72_S	75_E	1.319	0.74
4_F	48_T	1.258	0.70
104_K	123_E	1.249	0.70
45_A	82_P	1.239	0.69
11_S	23_R	1.233	0.69
19_M	121_L	1.214	0.67
81_K	105_A	1.195	0.66
6_V	43_V	1.170	0.65
58_I	90_N	1.168	0.64
42_M	126_V	1.158	0.64
16_V	58_I	1.155	0.63
43_V	114_K	1.144	0.63
5_A	40_Y	1.142	0.63
105_A	121_L	1.126	0.61
92_I	107_V	1.114	0.61
68_E	108_Q	1.097	0.59
15_T	117_V	1.093	0.59
70_G	73_E	1.092	0.59
17_A	33_A	1.085	0.59
12_Q	60_H	1.085	0.59
76_H	102_G	1.083	0.58
24_E	53_R	1.075	0.58
6_V	55_M	1.075	0.58
55_M	110_I	1.069	0.57
111_D	114_K	1.064	0.57
123_E	126_V	1.063	0.57
41_V	57_E	1.060	0.57
100_F	124_A	1.052	0.56
39_S	44_E	1.044	0.56
76_H	86_G	1.044	0.56
111_D	118_T	1.038	0.55
93_V	107_V	1.028	0.54
27_T	46_E	1.027	0.54
5_A	77_F	1.027	0.54
23_R	57_E	1.021	0.54
96_I	103_E	1.018	0.54
87_I	111_D	1.015	0.53
14_Q	35_D	1.015	0.53
87_I	107_V	1.015	0.53
89_E	105_A	0.995	0.52
32_L	77_F	0.979	0.51
41_V	45_A	0.978	0.51
92_I	123_E	0.977	0.51
48_T	58_I	0.976	0.51
79_S	87_I	0.967	0.50
10_A	42_M	0.967	0.50
20_I	64_L	0.956	0.49
103_E	120_E	0.949	0.49
22_N	79_S	0.937	0.48
16_V	40_Y	0.935	0.48
62_R	95_L	0.934	0.47
14_Q	31_V	0.929	0.47
39_S	117_V	0.925	0.47
29_H	48_T	0.913	0.46
30_A	112_E	0.912	0.46
115_D	125_T	0.912	0.46
95_L	102_G	0.909	0.46
27_T	50_A	0.904	0.45
9_T	62_R	0.902	0.45
20_I	43_V	0.895	0.45
83_D	90_N	0.893	0.44
32_L	124_A	0.893	0.44
92_I	124_A	0.887	0.44
75_E	78_L	0.881	0.44
41_V	113_G	0.868	0.43
39_S	116_Q	0.856	0.42
40_Y	91_D	0.850	0.41
18_S	41_V	0.850	0.41
60_H	64_L	0.847	0.41
18_S	101_K	0.838	0.40
45_A	50_A	0.825	0.40
34_P	37_L	0.823	0.39
72_S	85_E	0.819	0.39
72_S	80_P	0.817	0.39
84_V	119_V	0.802	0.38
78_L	95_L	0.798	0.38
12_Q	77_F	0.793	0.37
6_V	26_D	0.792	0.37
74_V	77_F	0.790	0.37
96_I	124_A	0.784	0.37
13_E	39_S	0.782	0.37
95_L	105_A	0.769	0.36
100_F	104_K	0.768	0.36
14_Q	18_S	0.765	0.35
97_A	107_V	0.763	0.35
94_E	126_V	0.755	0.35
37_L	42_M	0.750	0.34
32_L	75_E	0.748	0.34
57_E	122_Y	0.742	0.34
48_T	72_S	0.737	0.33
99_P	106_Q	0.727	0.33
79_S	127_P	0.725	0.33
30_A	57_E	0.725	0.33
69_S	106_Q	0.724	0.33
16_V	93_V	0.724	0.33
31_V	92_I	0.716	0.32
9_T	12_Q	0.715	0.32
7_K	40_Y	0.714	0.32
51_I	70_G	0.710	0.32
40_Y	58_I	0.706	0.31
96_I	100_F	0.704	0.31
66_P	93_V	0.701	0.31
57_E	61_A	0.690	0.30
3_V	37_L	0.689	0.30
72_S	87_I	0.688	0.30
99_P	119_V	0.687	0.30
55_M	88_A	0.681	0.30
20_I	61_A	0.676	0.30
41_V	74_V	0.669	0.29
115_D	127_P	0.663	0.29
21_A	69_S	0.661	0.29
59_P	95_L	0.659	0.29
100_F	123_E	0.659	0.29
15_T	113_G	0.646	0.28
25_E	39_S	0.644	0.28
60_H	109_R	0.640	0.27
100_F	105_A	0.635	0.27
4_F	104_K	0.632	0.27
12_Q	32_L	0.630	0.27
23_R	80_P	0.628	0.27
25_E	50_A	0.628	0.27
5_A	86_G	0.620	0.26
33_A	37_L	0.620	0.26
14_Q	73_E	0.617	0.26
42_M	104_K	0.610	0.26
104_K	124_A	0.609	0.26
87_I	91_D	0.605	0.25
35_D	73_E	0.599	0.25
19_M	100_F	0.597	0.25
46_E	102_G	0.592	0.25
61_A	82_P	0.590	0.25
31_V	105_A	0.581	0.24
49_A	87_I	0.578	0.24
69_S	107_V	0.575	0.24
91_D	95_L	0.573	0.24
82_P	110_I	0.570	0.23
13_E	31_V	0.555	0.23
8_T	13_E	0.553	0.23
90_N	102_G	0.552	0.23
17_A	32_L	0.546	0.22
120_E	129_P	0.543	0.22
38_T	43_V	0.542	0.22
21_A	106_Q	0.541	0.22
118_T	128_I	0.540	0.22
92_I	104_K	0.540	0.22
7_K	22_N	0.538	0.22
45_A	57_E	0.533	0.22
59_P	80_P	0.532	0.22
89_E	108_Q	0.531	0.21
98_G	111_D	0.530	0.21
51_I	55_M	0.528	0.21
18_S	23_R	0.528	0.21
29_H	51_I	0.526	0.21
49_A	76_H	0.526	0.21
83_D	92_I	0.523	0.21
84_V	108_Q	0.517	0.21
93_V	111_D	0.515	0.21
34_P	39_S	0.502	0.20
68_E	71_I	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3p8bB	2	0.9862	99.9	0.478	Contact Map
3h7hB	1	0.5724	99.9	0.478	Contact Map
2exuA	2	0.5724	99.9	0.499	Contact Map
2lq8A	1	0.9724	99.7	0.59	Contact Map
2jvvA	1	0.3931	99.7	0.612	Contact Map
2ougA	1	0.8069	99.6	0.645	Contact Map
1m1hA	1	0.5517	99.5	0.652	Contact Map
3lpeA	1	0.5517	99.4	0.683	Contact Map
2xhcA	1	0.931	99.3	0.695	Contact Map
1nz8A	1	0.5862	97.8	0.812	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.