Q9HS63 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS63 - Uncharacterized protein

UniProt:	Q9HS63	Sequences: MVDGDTDGGDAAEPAPGDGAQIASVTDLQAGDSFRFTVRDRDSGDEQEAILVALSDGSITGWLNYCMHWTDVTLDSGSGAVRDGELVCRKHAATFDPTSGVCTHGPCEGATLTAVDVTVQDGTVSLTDPDYEFVMQGVDPGDPADLSTSPGSRIGF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (127)
Sequences:	131 (97)
Seq/√Len:	8.6

HALSA - Q9HS63

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_L	32_D	3.121	0.91
52_V	115_V	3.063	0.90
81_V	139_D	2.624	0.82
21_Q	125_S	2.513	0.79
116_D	123_T	2.417	0.76
93_A	107_C	2.337	0.73
50_I	58_S	2.274	0.71
60_T	86_L	2.236	0.70
23_A	34_F	2.151	0.67
43_S	106_P	2.113	0.65
81_V	90_K	2.079	0.64
143_P	146_L	1.989	0.60
62_W	128_D	1.953	0.59
82_R	137_G	1.803	0.52
93_A	106_P	1.784	0.52
37_T	73_T	1.714	0.49
23_A	27_D	1.705	0.48
44_G	130_D	1.700	0.48
51_L	62_W	1.622	0.45
86_L	106_P	1.605	0.44
49_A	132_E	1.551	0.42
61_G	115_V	1.542	0.41
29_Q	109_G	1.504	0.40
56_D	143_P	1.490	0.39
61_G	142_D	1.484	0.39
26_T	139_D	1.479	0.39
35_R	133_F	1.467	0.38
87_V	127_T	1.445	0.37
48_E	137_G	1.432	0.37
97_P	139_D	1.425	0.37
103_T	117_V	1.414	0.36
32_D	67_M	1.389	0.35
26_T	127_T	1.359	0.34
89_R	96_D	1.359	0.34
83_D	101_V	1.355	0.34
26_T	31_G	1.332	0.33
55_S	59_I	1.288	0.31
81_V	97_P	1.288	0.31
37_T	71_D	1.241	0.30
37_T	90_K	1.233	0.29
93_A	110_A	1.225	0.29
27_D	34_F	1.214	0.29
55_S	62_W	1.164	0.27
38_V	99_S	1.163	0.27
111_T	114_A	1.148	0.27
101_V	109_G	1.148	0.27
25_V	124_V	1.147	0.27
69_W	94_T	1.144	0.26
40_D	113_T	1.131	0.26
69_W	148_T	1.116	0.26
19_G	120_Q	1.084	0.25
21_Q	123_T	1.081	0.24
76_S	90_K	1.068	0.24
42_D	140_P	1.066	0.24
37_T	69_W	1.064	0.24
27_D	31_G	1.060	0.24
54_L	60_T	1.056	0.24
51_L	117_V	1.047	0.23
73_T	83_D	1.045	0.23
98_T	107_C	1.040	0.23
22_I	42_D	1.027	0.23
36_F	123_T	1.023	0.23
50_I	75_D	1.010	0.22
39_R	116_D	0.994	0.22
34_F	131_Y	0.989	0.22
38_V	115_V	0.984	0.21
82_R	128_D	0.983	0.21
50_I	97_P	0.982	0.21
25_V	61_G	0.980	0.21
18_D	149_S	0.978	0.21
38_V	133_F	0.973	0.21
118_T	127_T	0.969	0.21
94_T	139_D	0.956	0.21
39_R	45_D	0.953	0.21
75_D	78_S	0.952	0.21
93_A	98_T	0.951	0.21
38_V	52_V	0.942	0.20
42_D	46_E	0.940	0.20
37_T	94_T	0.938	0.20
71_D	110_A	0.938	0.20
38_V	49_A	0.937	0.20
93_A	103_T	0.934	0.20
118_T	134_V	0.933	0.20
52_V	116_D	0.931	0.20
38_V	61_G	0.925	0.20
24_S	52_V	0.916	0.20
18_D	51_L	0.908	0.19
83_D	89_R	0.906	0.19
94_T	115_V	0.893	0.19
48_E	82_R	0.892	0.19
43_S	56_D	0.868	0.18
77_G	126_L	0.866	0.18
33_S	107_C	0.858	0.18
56_D	114_A	0.854	0.18
104_H	148_T	0.851	0.18
25_V	30_A	0.847	0.18
129_P	132_E	0.846	0.18
51_L	118_T	0.825	0.17
93_A	104_H	0.818	0.17
37_T	137_G	0.818	0.17
103_T	110_A	0.813	0.17
38_V	125_S	0.812	0.17
74_L	117_V	0.809	0.17
70_T	74_L	0.808	0.17
33_S	111_T	0.805	0.17
117_V	123_T	0.795	0.17
89_R	111_T	0.789	0.16
109_G	131_Y	0.781	0.16
29_Q	53_A	0.779	0.16
28_L	96_D	0.767	0.16
61_G	92_A	0.764	0.16
115_V	129_P	0.763	0.16
22_I	78_S	0.760	0.16
25_V	116_D	0.759	0.16
129_P	141_G	0.749	0.16
47_Q	127_T	0.743	0.15
20_A	23_A	0.743	0.15
143_P	147_S	0.732	0.15
24_S	122_G	0.730	0.15
82_R	85_E	0.727	0.15
26_T	140_P	0.725	0.15
91_H	100_G	0.724	0.15
64_N	105_G	0.724	0.15
66_C	88_C	0.724	0.15
66_C	91_H	0.724	0.15
66_C	100_G	0.724	0.15
66_C	105_G	0.724	0.15
68_H	88_C	0.724	0.15
68_H	91_H	0.724	0.15
68_H	105_G	0.724	0.15
100_G	105_G	0.724	0.15
91_H	105_G	0.724	0.15
68_H	100_G	0.724	0.15
64_N	100_G	0.724	0.15
64_N	91_H	0.724	0.15
64_N	88_C	0.724	0.15
88_C	91_H	0.724	0.15
88_C	100_G	0.724	0.15
88_C	105_G	0.724	0.15
64_N	68_H	0.724	0.15
45_D	130_D	0.719	0.15
71_D	90_K	0.718	0.15
107_C	148_T	0.717	0.15
42_D	56_D	0.717	0.15
23_A	38_V	0.711	0.15
25_V	127_T	0.707	0.15
86_L	101_V	0.688	0.14
65_Y	110_A	0.684	0.14
80_A	128_D	0.679	0.14
61_G	99_S	0.673	0.14
93_A	146_L	0.667	0.14
22_I	36_F	0.665	0.14
46_E	50_I	0.662	0.14
104_H	107_C	0.657	0.14
39_R	131_Y	0.646	0.13
95_F	119_V	0.644	0.13
104_H	108_E	0.632	0.13
21_Q	117_V	0.630	0.13
22_I	107_C	0.616	0.13
23_A	31_G	0.611	0.13
89_R	107_C	0.610	0.13
63_L	73_T	0.607	0.13
90_K	143_P	0.600	0.12
28_L	31_G	0.597	0.12
42_D	130_D	0.597	0.12
142_D	148_T	0.591	0.12
89_R	104_H	0.589	0.12
27_D	44_G	0.577	0.12
56_D	122_G	0.575	0.12
78_S	140_P	0.570	0.12
31_G	109_G	0.566	0.12
36_F	63_L	0.560	0.12
103_T	107_C	0.549	0.12
29_Q	46_E	0.547	0.12
55_S	58_S	0.547	0.12
70_T	133_F	0.544	0.11
63_L	113_T	0.540	0.11
62_W	87_V	0.540	0.11
27_D	130_D	0.536	0.11
65_Y	70_T	0.533	0.11
86_L	94_T	0.524	0.11
77_G	119_V	0.519	0.11
54_L	67_M	0.517	0.11
69_W	108_E	0.515	0.11
43_S	74_L	0.515	0.11
49_A	134_V	0.510	0.11
63_L	110_A	0.504	0.11
38_V	149_S	0.501	0.11
69_W	90_K	0.501	0.11
89_R	148_T	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gceA	1	0.6667	99.7	0.71	Contact Map
2jo6A	1	0.6667	99.7	0.713	Contact Map
3c0dA	1	0.6667	99.7	0.715	Contact Map
1rieA	1	0.6474	99.7	0.72	Contact Map
2i7fA	1	0.6538	99.7	0.721	Contact Map
2de6D	1	0.6603	99.7	0.723	Contact Map
2qpzA	1	0.6603	99.7	0.723	Contact Map
1fqtA	2	0.6987	99.7	0.723	Contact Map
3dqyA	1	0.6795	99.6	0.723	Contact Map
1vm9A	1	0.6987	99.6	0.727	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.