Q9HS57 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS57 - Uncharacterized protein

UniProt:	Q9HS57	Sequences: MDVSVSATGHDNVTARHDSTLELTTDDFLTPAGDCILGIDADCSPAAFSDAFVAACQDAAATITLVLDTPQHRDEITGSGHPDLTFTNDRSMVGRTSTYVDDRTVFVDADKAAADVDRELVAALADGAPLTATLRVD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	137 (131)
Sequences:	186 (129)
Seq/√Len:	11.3

HALSA - Q9HS57
SULSO - Q97WJ3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
78_G	106_F	3.839	0.99
93_V	103_R	3.469	0.98
29_L	33_G	3.191	0.96
91_S	101_D	3.104	0.96
28_F	39_I	2.776	0.92
91_S	103_R	2.624	0.90
21_L	67_L	2.422	0.86
67_L	130_L	2.217	0.80
74_D	111_K	2.198	0.79
116_V	120_L	2.127	0.77
112_A	115_D	2.123	0.77
69_T	120_L	2.061	0.75
7_A	26_D	2.030	0.73
45_P	48_F	1.934	0.70
45_P	105_V	1.934	0.70
93_V	101_D	1.856	0.66
30_T	33_G	1.854	0.66
5_V	41_A	1.773	0.63
25_T	44_S	1.753	0.62
68_D	71_Q	1.681	0.58
65_L	132_A	1.675	0.58
88_N	91_S	1.663	0.57
85_T	100_V	1.649	0.57
76_I	110_D	1.647	0.57
8_T	40_D	1.640	0.56
81_H	107_V	1.638	0.56
65_L	78_G	1.566	0.53
94_G	116_V	1.550	0.52
88_N	101_D	1.547	0.52
26_D	90_R	1.535	0.51
53_V	86_F	1.532	0.51
23_L	102_D	1.501	0.50
120_L	132_A	1.479	0.48
68_D	73_R	1.429	0.46
37_L	116_V	1.368	0.43
7_A	38_G	1.346	0.42
88_N	102_D	1.330	0.41
91_S	99_Y	1.330	0.41
90_R	101_D	1.293	0.40
23_L	87_T	1.268	0.38
13_V	27_D	1.261	0.38
59_A	110_D	1.257	0.38
5_V	42_D	1.237	0.37
74_D	117_D	1.209	0.36
42_D	134_L	1.199	0.35
25_T	111_K	1.197	0.35
85_T	102_D	1.188	0.35
44_S	88_N	1.182	0.35
5_V	51_A	1.173	0.34
11_D	98_T	1.172	0.34
28_F	99_Y	1.149	0.33
43_C	49_S	1.111	0.31
25_T	92_M	1.103	0.31
78_G	127_G	1.094	0.31
57_Q	76_I	1.084	0.30
64_T	93_V	1.077	0.30
5_V	71_Q	1.074	0.30
52_F	134_L	1.072	0.30
26_D	56_C	1.067	0.30
26_D	94_G	1.042	0.29
42_D	52_F	1.034	0.28
65_L	111_K	1.027	0.28
19_S	91_S	1.018	0.28
69_T	116_V	1.012	0.27
67_L	116_V	1.009	0.27
21_L	39_I	0.986	0.26
12_N	78_G	0.970	0.26
100_V	107_V	0.967	0.26
111_K	115_D	0.963	0.26
63_I	86_F	0.956	0.25
5_V	134_L	0.951	0.25
34_D	112_A	0.940	0.25
56_C	63_I	0.937	0.25
25_T	47_A	0.934	0.25
54_A	98_T	0.932	0.24
66_V	73_R	0.931	0.24
17_H	39_I	0.924	0.24
56_C	86_F	0.922	0.24
94_G	105_V	0.921	0.24
55_A	109_A	0.915	0.24
80_G	84_L	0.914	0.24
37_L	76_I	0.912	0.24
105_V	134_L	0.901	0.23
109_A	113_A	0.898	0.23
62_T	93_V	0.892	0.23
38_G	67_L	0.882	0.23
78_G	110_D	0.881	0.23
26_D	63_I	0.866	0.22
48_F	133_T	0.865	0.22
57_Q	85_T	0.857	0.22
111_K	116_V	0.850	0.22
15_A	121_V	0.844	0.21
19_S	52_F	0.840	0.21
21_L	94_G	0.825	0.21
69_T	89_D	0.819	0.21
71_Q	76_I	0.814	0.20
94_G	106_F	0.811	0.20
77_T	110_D	0.790	0.20
17_H	84_L	0.789	0.20
68_D	131_T	0.785	0.20
37_L	40_D	0.780	0.19
122_A	128_A	0.779	0.19
47_A	85_T	0.767	0.19
86_F	100_V	0.766	0.19
23_L	58_D	0.765	0.19
34_D	115_D	0.753	0.19
44_S	48_F	0.749	0.18
69_T	72_H	0.742	0.18
17_H	80_G	0.738	0.18
122_A	125_A	0.737	0.18
39_I	73_R	0.733	0.18
105_V	126_D	0.733	0.18
76_I	133_T	0.730	0.18
127_G	130_L	0.726	0.18
65_L	106_F	0.719	0.18
71_Q	89_D	0.713	0.17
56_C	106_F	0.703	0.17
42_D	49_S	0.698	0.17
62_T	126_D	0.696	0.17
26_D	102_D	0.693	0.17
50_D	116_V	0.690	0.17
50_D	105_V	0.689	0.17
19_S	67_L	0.674	0.16
5_V	84_L	0.671	0.16
55_A	112_A	0.669	0.16
31_P	113_A	0.668	0.16
106_F	117_D	0.668	0.16
21_L	86_F	0.666	0.16
42_D	123_A	0.664	0.16
26_D	40_D	0.662	0.16
74_D	120_L	0.660	0.16
50_D	54_A	0.660	0.16
38_G	130_L	0.655	0.16
46_A	61_A	0.654	0.16
107_V	121_V	0.653	0.16
19_S	89_D	0.651	0.16
70_P	100_V	0.648	0.16
45_P	109_A	0.641	0.16
110_D	114_A	0.639	0.15
87_T	102_D	0.638	0.15
48_F	128_A	0.636	0.15
13_V	51_A	0.634	0.15
38_G	115_D	0.633	0.15
28_F	91_S	0.633	0.15
18_D	46_A	0.632	0.15
21_L	88_N	0.625	0.15
63_I	108_D	0.622	0.15
69_T	76_I	0.621	0.15
63_I	134_L	0.619	0.15
23_L	45_P	0.618	0.15
70_P	82_P	0.615	0.15
18_D	76_I	0.613	0.15
62_T	108_D	0.610	0.15
62_T	103_R	0.604	0.15
54_A	94_G	0.603	0.15
28_F	33_G	0.603	0.15
11_D	19_S	0.601	0.15
66_V	74_D	0.592	0.14
69_T	105_V	0.585	0.14
6_S	42_D	0.584	0.14
32_A	125_A	0.584	0.14
18_D	111_K	0.581	0.14
62_T	73_R	0.576	0.14
65_L	134_L	0.573	0.14
4_S	131_T	0.572	0.14
28_F	88_N	0.572	0.14
23_L	39_I	0.570	0.14
8_T	70_P	0.568	0.14
56_C	107_V	0.560	0.14
59_A	79_S	0.559	0.14
47_A	98_T	0.557	0.13
15_A	110_D	0.555	0.13
46_A	88_N	0.555	0.13
60_A	74_D	0.553	0.13
18_D	48_F	0.552	0.13
12_N	31_P	0.550	0.13
78_G	94_G	0.547	0.13
4_S	77_T	0.547	0.13
7_A	48_F	0.544	0.13
61_A	112_A	0.539	0.13
14_T	127_G	0.539	0.13
44_S	65_L	0.538	0.13
74_D	100_V	0.538	0.13
68_D	121_V	0.535	0.13
18_D	44_S	0.534	0.13
30_T	39_I	0.533	0.13
15_A	45_P	0.532	0.13
26_D	61_A	0.531	0.13
86_F	89_D	0.528	0.13
63_I	103_R	0.527	0.13
66_V	93_V	0.524	0.13
106_F	127_G	0.514	0.13
32_A	57_Q	0.513	0.13
117_D	122_A	0.501	0.12
65_L	92_M	0.501	0.12
59_A	82_P	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cbnA	1	0.9927	100	0.045	Contact Map
2rodB	1	0.1971	13.9	0.953	Contact Map
3k7pA	4	0.2701	12.6	0.954	Contact Map
3pl5A	1	0.219	12.4	0.954	Contact Map
2pt5A	2	0.8905	11.8	0.954	Contact Map
4cnkA	2	0.4599	7.6	0.958	Contact Map
3fysA	1	0.2336	6.2	0.96	Contact Map
2odfA	2	0.8394	6	0.96	Contact Map
3akoA	1	0.4088	5.7	0.961	Contact Map
1xgwA	1	0.4599	5.5	0.961	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.