Q9HS38 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS38 - Uncharacterized protein

UniProt:	Q9HS38	Sequences: MQDAGIPALRTVAAYQYGAAAGRALFPEDKPHHVQRSSTGRPQQIHRDDGARLVSVGLDGRLTLGPAGGQRLIDALEHPRARVVVGDESEPFVRDGKNVFAKFVTDVDDDARQGDELAVVHEDGRLLAVGRAELDAASMRDFETGMAVSVRAGVPATDA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	159 (144)
Sequences:	417 (316)
Seq/√Len:	26.3

HALSA - Q9HS38 Q9HNT2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
111_A	132_A	4.336	1.00
132_A	139_M	3.690	1.00
79_P	82_R	3.502	1.00
121_H	125_R	3.371	1.00
107_V	136_A	3.256	1.00
128_A	150_V	3.168	1.00
14_A	22_G	2.775	1.00
135_D	138_S	2.623	0.99
14_A	20_A	2.585	0.99
104_V	147_A	2.376	0.99
107_V	111_A	2.220	0.98
111_A	117_L	2.181	0.97
51_A	67_A	2.172	0.97
13_A	25_L	2.162	0.97
118_A	126_L	2.157	0.97
67_A	70_Q	2.131	0.97
87_D	122_E	1.998	0.96
111_A	136_A	1.990	0.95
90_E	121_H	1.956	0.95
119_V	148_V	1.883	0.94
10_R	22_G	1.875	0.94
17_Y	64_L	1.674	0.89
116_E	151_R	1.670	0.89
132_A	136_A	1.588	0.86
106_D	140_R	1.572	0.86
13_A	64_L	1.554	0.85
134_L	142_F	1.550	0.85
83_V	139_M	1.538	0.85
69_G	129_V	1.461	0.81
111_A	139_M	1.444	0.81
62_L	96_G	1.421	0.80
99_V	119_V	1.408	0.79
108_D	136_A	1.408	0.79
98_N	146_M	1.386	0.78
129_V	152_A	1.377	0.77
120_V	124_G	1.369	0.77
139_M	147_A	1.368	0.77
119_V	128_A	1.339	0.75
85_V	99_V	1.337	0.75
79_P	124_G	1.277	0.72
68_G	71_R	1.268	0.71
66_P	152_A	1.249	0.70
13_A	20_A	1.246	0.70
32_H	46_H	1.243	0.70
38_S	43_Q	1.225	0.68
73_I	124_G	1.224	0.68
107_V	132_A	1.208	0.67
81_A	110_D	1.187	0.66
82_R	108_D	1.186	0.66
99_V	141_D	1.180	0.65
83_V	148_V	1.170	0.65
128_A	147_A	1.160	0.64
21_A	24_A	1.150	0.63
16_Q	116_E	1.135	0.62
98_N	131_R	1.124	0.62
92_F	147_A	1.120	0.61
17_Y	62_L	1.117	0.61
52_R	65_G	1.096	0.60
89_S	131_R	1.094	0.59
106_D	141_D	1.087	0.59
90_E	94_R	1.084	0.59
22_G	64_L	1.077	0.58
119_V	150_V	1.065	0.57
24_A	120_V	1.055	0.57
39_T	42_P	1.039	0.55
52_R	63_T	1.035	0.55
84_V	118_A	1.018	0.54
108_D	120_V	1.007	0.53
87_D	123_D	0.992	0.52
40_G	43_Q	0.987	0.52
13_A	22_G	0.965	0.50
101_A	147_A	0.963	0.50
59_D	72_L	0.940	0.48
104_V	113_Q	0.924	0.47
86_G	105_T	0.911	0.46
20_A	27_P	0.910	0.46
78_H	140_R	0.903	0.45
64_L	68_G	0.887	0.44
44_Q	52_R	0.886	0.44
85_V	89_S	0.883	0.44
62_L	85_V	0.878	0.44
81_A	117_L	0.876	0.43
99_V	102_K	0.871	0.43
70_Q	109_D	0.862	0.42
26_F	150_V	0.862	0.42
30_K	133_E	0.861	0.42
45_I	62_L	0.857	0.42
86_G	89_S	0.854	0.42
89_S	129_V	0.853	0.42
68_G	138_S	0.852	0.42
87_D	90_E	0.845	0.41
97_K	103_F	0.834	0.40
31_P	37_S	0.834	0.40
9_L	129_V	0.832	0.40
102_K	142_F	0.830	0.40
70_Q	74_D	0.818	0.39
104_V	146_M	0.815	0.39
17_Y	139_M	0.815	0.39
64_L	69_G	0.815	0.39
17_Y	111_A	0.808	0.39
62_L	72_L	0.805	0.38
103_F	142_F	0.798	0.38
9_L	150_V	0.796	0.38
107_V	139_M	0.796	0.38
39_T	138_S	0.795	0.38
13_A	54_V	0.792	0.37
54_V	62_L	0.791	0.37
38_S	41_R	0.787	0.37
101_A	112_R	0.784	0.37
17_Y	115_D	0.778	0.36
114_G	144_T	0.774	0.36
90_E	112_R	0.770	0.36
100_F	131_R	0.770	0.36
101_A	134_L	0.766	0.36
6_I	34_V	0.758	0.35
105_T	123_D	0.750	0.35
120_V	126_L	0.743	0.34
82_R	124_G	0.741	0.34
49_D	143_E	0.733	0.33
6_I	30_K	0.731	0.33
50_G	69_G	0.731	0.33
56_V	62_L	0.729	0.33
120_V	153_G	0.724	0.33
101_A	123_D	0.724	0.33
90_E	125_R	0.720	0.33
20_A	50_G	0.720	0.33
108_D	146_M	0.716	0.32
100_F	121_H	0.716	0.32
23_R	98_N	0.714	0.32
46_H	150_V	0.713	0.32
53_L	104_V	0.710	0.32
140_R	154_V	0.708	0.32
38_S	46_H	0.705	0.32
84_V	122_E	0.703	0.31
105_T	126_L	0.701	0.31
93_V	144_T	0.700	0.31
41_R	62_L	0.699	0.31
52_R	88_E	0.697	0.31
82_R	120_V	0.691	0.31
32_H	103_F	0.686	0.30
88_E	150_V	0.684	0.30
40_G	60_G	0.681	0.30
77_E	119_V	0.681	0.30
113_Q	140_R	0.680	0.30
32_H	139_M	0.673	0.30
31_P	50_G	0.650	0.28
27_P	30_K	0.649	0.28
70_Q	140_R	0.648	0.28
45_I	51_A	0.647	0.28
82_R	118_A	0.643	0.28
27_P	129_V	0.642	0.28
34_V	44_Q	0.641	0.28
72_L	126_L	0.637	0.27
67_A	123_D	0.637	0.27
13_A	21_A	0.636	0.27
73_I	128_A	0.636	0.27
89_S	115_D	0.634	0.27
104_V	148_V	0.633	0.27
34_V	60_G	0.631	0.27
93_V	121_H	0.631	0.27
38_S	49_D	0.626	0.27
40_G	61_R	0.624	0.27
109_D	140_R	0.624	0.27
24_A	28_E	0.621	0.26
9_L	57_G	0.620	0.26
49_D	133_E	0.618	0.26
25_L	64_L	0.615	0.26
42_P	59_D	0.611	0.26
37_S	44_Q	0.602	0.25
122_E	131_R	0.601	0.25
82_R	126_L	0.599	0.25
66_P	141_D	0.597	0.25
113_Q	134_L	0.596	0.25
68_G	92_F	0.595	0.25
29_D	50_G	0.592	0.25
133_E	148_V	0.591	0.25
121_H	131_R	0.589	0.25
86_G	103_F	0.587	0.25
134_L	154_V	0.583	0.24
62_L	83_V	0.579	0.24
97_K	151_R	0.579	0.24
22_G	97_K	0.577	0.24
8_A	32_H	0.574	0.24
37_S	103_F	0.568	0.23
89_S	93_V	0.568	0.23
113_Q	135_D	0.567	0.23
80_R	118_A	0.564	0.23
109_D	137_A	0.562	0.23
87_D	91_P	0.560	0.23
26_F	146_M	0.551	0.23
100_F	124_G	0.550	0.23
98_N	142_F	0.546	0.22
37_S	60_G	0.545	0.22
23_R	105_T	0.544	0.22
121_H	124_G	0.544	0.22
66_P	70_Q	0.542	0.22
63_T	85_V	0.537	0.22
22_G	27_P	0.530	0.22
34_V	37_S	0.529	0.21
11_T	25_L	0.528	0.21
109_D	127_L	0.524	0.21
49_D	58_L	0.524	0.21
50_G	70_Q	0.523	0.21
9_L	80_R	0.520	0.21
126_L	153_G	0.519	0.21
29_D	85_V	0.518	0.21
93_V	129_V	0.517	0.21
29_D	148_V	0.515	0.21
56_V	133_E	0.506	0.20
106_D	137_A	0.505	0.20
110_D	134_L	0.504	0.20
31_P	53_L	0.504	0.20
119_V	141_D	0.504	0.20
7_P	123_D	0.504	0.20
105_T	109_D	0.502	0.20
43_Q	57_G	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1iq8A	2	0.9434	100	0.431	Contact Map
3d79A	1	0.9748	100	0.489	Contact Map
2q07A	1	0.8113	99.9	0.516	Contact Map
3r90A	5	0.9623	99.9	0.528	Contact Map
1q7hA	2	0.8994	99.9	0.531	Contact Map
2cx0A	1	0.9497	99.9	0.56	Contact Map
2p38A	4	0.8302	99.8	0.634	Contact Map
3zv0C	2	0.7233	99.6	0.687	Contact Map
2apoA	1	0.8742	98.9	0.782	Contact Map
2ausC	1	0.9686	98.9	0.784	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.