Q9HS30 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS30 - Uncharacterized protein

UniProt:	Q9HS30	Sequences: MAYPEWVRRIVAIENKPDLDASAADALTTQLRRDVALGLADEVWVATADDAAGGVQRALLADLPVEAGILVFDDDWTVTVEWLPHGLATAASGTRLTSRPADGADRPATGFEYVDADWKAHTRLAIAERAFERGWRSYVDTMRPDCRQFRLVDGAHGYVPACAAKAREQSAAECGGSCADYEPEPPGWRQHGWPIEGGPGATVQAVLADRRQRRRE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	216 (195)
Sequences:	106 (76)
Seq/√Len:	5.5

HALSA - Q9HS30 Q9HNK8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_L	69_I	6.704	1.00
12_A	137_S	3.983	0.92
40_A	170_S	3.329	0.82
165_K	173_E	3.208	0.79
200_G	207_L	3.029	0.75
161_A	202_T	2.835	0.70
38_G	88_A	2.657	0.64
116_A	185_P	2.639	0.64
88_A	91_A	2.572	0.62
138_Y	212_Q	2.557	0.61
58_A	69_I	2.431	0.57
61_A	110_G	2.384	0.56
186_P	212_Q	2.331	0.54
205_A	209_D	2.031	0.44
60_L	81_E	2.011	0.43
10_I	31_L	1.977	0.42
86_G	182_E	1.967	0.42
44_W	203_V	1.879	0.39
66_E	84_P	1.852	0.38
102_D	159_V	1.804	0.36
33_R	138_Y	1.726	0.34
40_A	72_F	1.683	0.33
45_V	63_L	1.660	0.32
44_W	173_E	1.634	0.31
81_E	195_I	1.632	0.31
75_D	147_R	1.627	0.31
57_R	114_V	1.591	0.30
9_R	126_I	1.590	0.30
26_A	101_A	1.578	0.30
96_L	99_R	1.565	0.29
83_L	124_L	1.557	0.29
57_R	148_Q	1.554	0.29
9_R	138_Y	1.551	0.29
89_T	181_Y	1.543	0.29
48_A	54_G	1.531	0.28
98_S	116_A	1.511	0.28
154_G	159_V	1.510	0.28
58_A	175_G	1.497	0.27
115_D	138_Y	1.478	0.27
45_V	58_A	1.466	0.26
84_P	99_R	1.457	0.26
78_V	170_S	1.448	0.26
39_L	122_T	1.426	0.25
138_Y	166_A	1.425	0.25
40_A	73_D	1.383	0.24
172_A	210_R	1.382	0.24
10_I	57_R	1.380	0.24
112_E	151_L	1.378	0.24
42_E	138_Y	1.377	0.24
36_A	113_Y	1.370	0.24
28_T	200_G	1.361	0.24
177_S	196_E	1.332	0.23
169_Q	176_G	1.315	0.23
171_A	186_P	1.296	0.22
199_P	211_R	1.276	0.22
9_R	196_E	1.258	0.21
118_W	155_A	1.253	0.21
124_L	166_A	1.240	0.21
165_K	183_P	1.238	0.21
38_G	167_R	1.230	0.21
95_R	133_R	1.228	0.21
94_T	112_E	1.226	0.21
10_I	13_I	1.219	0.20
38_G	177_S	1.215	0.20
2_A	62_D	1.212	0.20
74_D	170_S	1.202	0.20
138_Y	157_G	1.199	0.20
42_E	145_D	1.197	0.20
117_D	163_A	1.196	0.20
28_T	97_T	1.194	0.20
28_T	151_L	1.189	0.20
13_I	79_T	1.186	0.20
7_V	36_A	1.178	0.20
199_P	205_A	1.176	0.20
77_T	126_I	1.174	0.20
2_A	201_A	1.173	0.19
73_D	170_S	1.166	0.19
8_R	122_T	1.164	0.19
88_A	122_T	1.156	0.19
102_D	155_A	1.150	0.19
45_V	62_D	1.135	0.19
172_A	181_Y	1.116	0.18
13_I	120_A	1.113	0.18
35_V	38_G	1.096	0.18
7_V	74_D	1.085	0.18
138_Y	213_R	1.083	0.18
39_L	215_R	1.074	0.17
44_W	200_G	1.072	0.17
33_R	203_V	1.054	0.17
155_A	202_T	1.050	0.17
66_E	173_E	1.034	0.17
32_R	101_A	1.033	0.17
67_A	196_E	1.026	0.17
69_I	81_E	1.019	0.16
98_S	161_A	1.005	0.16
167_R	201_A	1.004	0.16
13_I	57_R	0.999	0.16
116_A	184_E	0.991	0.16
92_S	117_D	0.989	0.16
69_I	90_A	0.988	0.16
89_T	116_A	0.985	0.16
92_S	171_A	0.981	0.16
99_R	112_E	0.981	0.16
42_E	207_L	0.979	0.16
143_R	201_A	0.970	0.16
20_D	207_L	0.968	0.15
40_A	198_G	0.967	0.15
12_A	168_E	0.965	0.15
7_V	99_R	0.964	0.15
39_L	91_A	0.963	0.15
35_V	161_A	0.929	0.15
165_K	185_P	0.927	0.15
12_A	175_G	0.924	0.15
11_V	137_S	0.923	0.15
35_V	98_S	0.912	0.15
29_T	145_D	0.906	0.14
85_H	117_D	0.905	0.14
72_F	170_S	0.905	0.14
29_T	154_G	0.903	0.14
97_T	138_Y	0.898	0.14
72_F	79_T	0.891	0.14
10_I	206_V	0.888	0.14
198_G	213_R	0.883	0.14
125_A	209_D	0.882	0.14
165_K	184_E	0.878	0.14
35_V	92_S	0.875	0.14
100_P	110_G	0.871	0.14
40_A	78_V	0.869	0.14
102_D	196_E	0.865	0.14
10_I	213_R	0.865	0.14
49_D	167_R	0.863	0.14
72_F	203_V	0.858	0.14
72_F	78_V	0.857	0.14
110_G	116_A	0.857	0.14
78_V	198_G	0.854	0.14
103_G	110_G	0.854	0.14
118_W	171_A	0.850	0.14
76_W	202_T	0.845	0.13
96_L	195_I	0.840	0.13
5_E	80_V	0.839	0.13
66_E	196_E	0.839	0.13
77_T	168_E	0.837	0.13
112_E	171_A	0.829	0.13
84_P	87_L	0.828	0.13
77_T	173_E	0.824	0.13
40_A	74_D	0.816	0.13
65_V	171_A	0.815	0.13
126_I	201_A	0.813	0.13
118_W	153_D	0.813	0.13
89_T	100_P	0.812	0.13
124_L	176_G	0.811	0.13
31_L	77_T	0.809	0.13
186_P	189_R	0.808	0.13
48_A	168_E	0.806	0.13
89_T	113_Y	0.806	0.13
99_R	203_V	0.804	0.13
197_G	210_R	0.803	0.13
39_L	42_E	0.801	0.13
11_V	91_A	0.800	0.13
91_A	180_D	0.799	0.13
35_V	150_R	0.792	0.13
45_V	133_R	0.789	0.13
57_R	69_I	0.781	0.12
67_A	121_H	0.780	0.12
76_W	90_A	0.779	0.12
83_L	175_G	0.779	0.12
36_A	122_T	0.777	0.12
54_G	110_G	0.776	0.12
154_G	166_A	0.773	0.12
90_A	215_R	0.769	0.12
72_F	158_Y	0.766	0.12
149_F	164_A	0.762	0.12
7_V	72_F	0.761	0.12
202_T	205_A	0.754	0.12
84_P	93_G	0.754	0.12
151_L	164_A	0.753	0.12
37_L	119_K	0.749	0.12
79_T	172_A	0.735	0.12
43_V	204_Q	0.733	0.12
57_R	60_L	0.733	0.12
20_D	63_L	0.728	0.12
86_G	177_S	0.728	0.12
155_A	186_P	0.727	0.12
29_T	163_A	0.725	0.12
75_D	114_V	0.721	0.12
116_A	139_V	0.718	0.12
155_A	181_Y	0.715	0.12
114_V	180_D	0.712	0.11
145_D	188_W	0.710	0.11
79_T	201_A	0.700	0.11
120_A	124_L	0.698	0.11
10_I	184_E	0.697	0.11
61_A	111_F	0.693	0.11
102_D	170_S	0.693	0.11
45_V	49_D	0.688	0.11
65_V	152_V	0.687	0.11
65_V	196_E	0.685	0.11
25_D	61_A	0.682	0.11
111_F	147_R	0.677	0.11
200_G	206_V	0.675	0.11
56_Q	70_L	0.672	0.11
169_Q	184_E	0.670	0.11
40_A	149_F	0.669	0.11
155_A	158_Y	0.667	0.11
73_D	99_R	0.659	0.11
5_E	89_T	0.655	0.11
92_S	110_G	0.653	0.11
99_R	184_E	0.651	0.11
150_R	213_R	0.650	0.11
122_T	215_R	0.649	0.11
29_T	200_G	0.649	0.11
171_A	188_W	0.648	0.11
199_P	203_V	0.648	0.11
159_V	173_E	0.647	0.11
91_A	166_A	0.647	0.11
151_L	183_P	0.642	0.11
152_V	196_E	0.641	0.11
137_S	214_R	0.639	0.11
5_E	101_A	0.632	0.10
38_G	90_A	0.632	0.10
139_V	208_A	0.626	0.10
11_V	79_T	0.623	0.10
145_D	213_R	0.622	0.10
198_G	201_A	0.610	0.10
84_P	183_P	0.609	0.10
122_T	148_Q	0.607	0.10
184_E	188_W	0.606	0.10
58_A	62_D	0.605	0.10
149_F	170_S	0.605	0.10
67_A	161_A	0.601	0.10
20_D	126_I	0.600	0.10
12_A	38_G	0.595	0.10
122_T	126_I	0.593	0.10
147_R	189_R	0.590	0.10
5_E	131_F	0.586	0.10
76_W	213_R	0.585	0.10
65_V	177_S	0.583	0.10
173_E	176_G	0.582	0.10
81_E	152_V	0.582	0.10
177_S	183_P	0.582	0.10
78_V	155_A	0.577	0.10
35_V	159_V	0.576	0.10
63_L	166_A	0.574	0.10
37_L	93_G	0.573	0.10
185_P	188_W	0.572	0.10
11_V	148_Q	0.571	0.10
11_V	168_E	0.569	0.10
26_A	71_V	0.569	0.10
111_F	133_R	0.569	0.10
75_D	154_G	0.567	0.10
37_L	190_Q	0.566	0.10
74_D	78_V	0.565	0.10
54_G	112_E	0.564	0.10
61_A	133_R	0.564	0.10
31_L	161_A	0.563	0.10
28_T	55_V	0.556	0.09
25_D	62_D	0.555	0.09
138_Y	215_R	0.549	0.09
71_V	175_G	0.546	0.09
147_R	197_G	0.546	0.09
20_D	198_G	0.541	0.09
9_R	42_E	0.539	0.09
38_G	101_A	0.537	0.09
102_D	149_F	0.537	0.09
203_V	209_D	0.535	0.09
202_T	209_D	0.535	0.09
80_V	125_A	0.534	0.09
43_V	67_A	0.534	0.09
165_K	186_P	0.533	0.09
66_E	185_P	0.533	0.09
10_I	153_D	0.533	0.09
38_G	126_I	0.532	0.09
7_V	122_T	0.528	0.09
152_V	165_K	0.526	0.09
65_V	211_R	0.524	0.09
2_A	45_V	0.523	0.09
115_D	179_A	0.518	0.09
42_E	182_E	0.518	0.09
93_G	119_K	0.517	0.09
25_D	49_D	0.516	0.09
113_Y	143_R	0.515	0.09
77_T	86_G	0.514	0.09
94_T	185_P	0.512	0.09
75_D	121_H	0.511	0.09
62_D	125_A	0.510	0.09
82_W	199_P	0.508	0.09
96_L	116_A	0.507	0.09
89_T	102_D	0.504	0.09
73_D	157_G	0.501	0.09
31_L	55_V	0.500	0.09
171_A	176_G	0.500	0.09
73_D	158_Y	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3dnxA	2	0.4954	38.6	0.966	Contact Map
4ldvA	2	0.2315	4.5	0.978	Contact Map
1z0jA	1	0.287	4.2	0.979	Contact Map
4hi0E	2	0.2824	4.1	0.979	Contact Map
3sxuA	1	0.4676	3.8	0.979	Contact Map
4lduA	2	0.2315	3.8	0.979	Contact Map
1z08A	2	0.2917	3.6	0.979	Contact Map
3rlgA	1	0.537	3.5	0.979	Contact Map
3c5hA	1	0.2824	3.1	0.98	Contact Map
3vdpA	2	0.4491	3.1	0.98	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.