Q9HS29 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS29 - Diadenosine tetraphosphate pyrophosphohydrolase

UniProt:	Q9HS29	Sequences: MTVEATSAGAILFRDTRDRREYLLLKSRPGDWEFPKGGVEGDEELQQTAIREVQEEAGIEDFRLVDGFRDEYDYVFEANGDRIHKTVHLFIAKSFEASAELSNEHSDLQWRDYDQAVNTITQDGPREILEDAHVFIDEDADI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	142 (126)
Sequences:	1969 (1318)
Seq/√Len:	117.4

ECOLI - MUTT NUDJ NUDG
BACSU - MUTT YVCI YJHB
HALSA - Q9HS29 Q9HR46
SULSO - Q97WE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_V	48_T	4.071	1.00
10_A	53_V	3.457	1.00
14_R	21_E	3.277	1.00
109_Q	119_T	3.238	1.00
54_Q	60_E	3.120	1.00
117_V	130_E	2.987	1.00
10_A	92_A	2.960	1.00
70_D	131_D	2.678	1.00
111_R	119_T	2.582	1.00
53_V	92_A	2.487	1.00
25_L	105_H	2.178	1.00
91_I	132_A	2.157	1.00
63_R	93_K	2.143	1.00
26_K	106_S	2.037	1.00
44_E	47_Q	2.019	1.00
112_D	115_Q	1.972	1.00
113_Y	133_H	1.866	1.00
70_D	128_I	1.844	1.00
6_T	88_H	1.816	1.00
15_D	93_K	1.754	1.00
74_Y	87_V	1.713	1.00
99_A	108_L	1.631	1.00
16_T	21_E	1.631	1.00
39_V	45_L	1.594	1.00
24_L	111_R	1.579	1.00
45_L	88_H	1.531	1.00
12_L	59_I	1.448	1.00
15_D	20_R	1.397	1.00
99_A	102_S	1.371	1.00
6_T	45_L	1.365	1.00
36_K	85_K	1.359	1.00
50_I	64_L	1.329	1.00
12_L	53_V	1.315	1.00
46_Q	64_L	1.311	1.00
45_L	48_T	1.274	0.99
22_Y	113_Y	1.266	0.99
102_S	105_H	1.262	0.99
32_W	109_Q	1.235	0.99
26_K	107_D	1.224	0.99
73_D	84_H	1.203	0.99
63_R	95_F	1.191	0.99
6_T	86_T	1.181	0.99
120_I	129_L	1.173	0.99
5_A	38_G	1.158	0.99
115_Q	118_N	1.144	0.99
62_F	92_A	1.134	0.99
50_I	54_Q	1.125	0.99
26_K	30_G	1.123	0.99
33_E	105_H	1.115	0.99
13_F	91_I	1.115	0.99
71_E	88_H	1.114	0.99
16_T	19_R	1.113	0.99
75_V	84_H	1.089	0.98
22_Y	133_H	1.068	0.98
59_I	62_F	1.037	0.98
22_Y	129_L	1.036	0.98
23_L	108_L	1.030	0.98
67_G	88_H	1.025	0.98
8_A	48_T	1.023	0.98
34_F	128_I	1.021	0.98
72_Y	128_I	1.016	0.97
66_D	135_F	1.010	0.97
9_G	36_K	1.005	0.97
27_S	33_E	1.005	0.97
71_E	86_T	1.004	0.97
32_W	107_D	0.990	0.97
5_A	76_F	0.989	0.97
123_D	126_R	0.977	0.97
65_V	91_I	0.973	0.97
60_E	96_E	0.971	0.97
34_F	129_L	0.971	0.97
67_G	70_D	0.955	0.96
15_D	18_D	0.953	0.96
120_I	125_P	0.947	0.96
22_Y	34_F	0.915	0.95
8_A	45_L	0.914	0.95
10_A	64_L	0.901	0.95
85_K	104_E	0.888	0.94
72_Y	89_L	0.866	0.94
57_A	97_A	0.863	0.94
68_F	135_F	0.863	0.94
25_L	33_E	0.860	0.93
28_R	106_S	0.848	0.93
15_D	19_R	0.844	0.93
109_Q	115_Q	0.840	0.93
21_E	112_D	0.836	0.92
116_A	129_L	0.835	0.92
73_D	86_T	0.821	0.92
8_A	49_A	0.812	0.91
115_Q	119_T	0.811	0.91
12_L	23_L	0.809	0.91
74_Y	85_K	0.808	0.91
27_S	31_D	0.806	0.91
36_K	49_A	0.794	0.90
50_I	62_F	0.784	0.90
111_R	116_A	0.777	0.89
36_K	89_L	0.771	0.89
122_Q	128_I	0.758	0.88
123_D	130_E	0.757	0.88
9_G	49_A	0.754	0.88
31_D	105_H	0.745	0.87
23_L	59_I	0.737	0.87
9_G	85_K	0.724	0.86
64_L	92_A	0.723	0.86
13_F	65_V	0.716	0.85
11_I	22_Y	0.713	0.85
19_R	112_D	0.712	0.85
29_P	106_S	0.712	0.85
13_F	132_A	0.708	0.85
59_I	94_S	0.696	0.84
87_V	104_E	0.690	0.83
14_R	110_W	0.686	0.83
10_A	62_F	0.682	0.82
11_I	132_A	0.662	0.80
30_G	106_S	0.660	0.80
98_S	134_V	0.658	0.80
35_P	49_A	0.658	0.80
28_R	57_A	0.652	0.79
78_A	83_I	0.649	0.79
36_K	74_Y	0.647	0.79
105_H	125_P	0.647	0.79
33_E	125_P	0.644	0.79
36_K	120_I	0.637	0.78
32_W	111_R	0.637	0.78
128_I	132_A	0.634	0.78
40_E	124_G	0.634	0.78
131_D	134_V	0.632	0.77
20_R	133_H	0.630	0.77
11_I	34_F	0.627	0.77
50_I	92_A	0.618	0.76
25_L	102_S	0.612	0.75
33_E	87_V	0.611	0.75
44_E	48_T	0.603	0.74
11_I	72_Y	0.602	0.74
34_F	125_P	0.602	0.74
68_F	88_H	0.602	0.74
10_A	76_F	0.600	0.74
11_I	128_I	0.598	0.73
7_S	87_V	0.598	0.73
21_E	60_E	0.597	0.73
65_V	93_K	0.596	0.73
105_H	110_W	0.594	0.73
76_F	79_N	0.587	0.72
74_Y	78_A	0.585	0.72
59_I	96_E	0.577	0.71
36_K	87_V	0.575	0.70
19_R	123_D	0.573	0.70
46_Q	50_I	0.569	0.70
33_E	38_G	0.567	0.69
50_I	134_V	0.567	0.69
7_S	104_E	0.564	0.69
118_N	130_E	0.564	0.69
129_L	133_H	0.563	0.69
12_L	15_D	0.563	0.69
24_L	34_F	0.563	0.69
10_A	49_A	0.562	0.69
98_S	114_D	0.561	0.69
68_F	132_A	0.559	0.68
27_S	89_L	0.558	0.68
76_F	83_I	0.556	0.68
112_D	116_A	0.553	0.67
109_Q	126_R	0.552	0.67
17_R	114_D	0.552	0.67
130_E	134_V	0.549	0.67
15_D	95_F	0.548	0.67
54_Q	58_G	0.547	0.67
31_D	38_G	0.545	0.66
27_S	104_E	0.544	0.66
85_K	89_L	0.544	0.66
111_R	115_Q	0.544	0.66
5_A	83_I	0.543	0.66
46_Q	90_F	0.543	0.66
22_Y	68_F	0.540	0.66
38_G	45_L	0.536	0.65
63_R	118_N	0.534	0.65
117_V	133_H	0.531	0.64
12_L	49_A	0.530	0.64
13_F	22_Y	0.526	0.64
89_L	125_P	0.524	0.63
36_K	122_Q	0.521	0.63
47_Q	50_I	0.521	0.63
24_L	116_A	0.521	0.63
27_S	90_F	0.517	0.62
60_E	98_S	0.516	0.62
105_H	108_L	0.511	0.61
94_S	97_A	0.508	0.61
123_D	127_E	0.507	0.61
49_A	92_A	0.501	0.60
23_L	62_F	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3i7uA	4	0.9437	99.9	0.387	Contact Map
3fjyA	2	0.9577	99.9	0.389	Contact Map
4ickA	1	0.9296	99.9	0.408	Contact Map
1ktgA	1	0.9155	99.9	0.427	Contact Map
2azwA	1	0.9155	99.9	0.438	Contact Map
4mpoA	4	0.9789	99.9	0.44	Contact Map
1vcdA	1	0.8873	99.9	0.448	Contact Map
2qjtB	2	0.9225	99.9	0.462	Contact Map
1k2eA	2	0.8803	99.9	0.468	Contact Map
3sonA	2	0.9507	99.9	0.474	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.