Q9HS23 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS23 - Ferredoxin

UniProt:	Q9HS23	Sequences: MTEYTVEFAGAGETIEVSDTETILKACLREGIAQEYSCRVGMCLACSAKIESGDVTQPAARGLTDAEADEYALTCMARPQTDLVLDRGKYPPSIEEEAAVADQAAADDD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	109 (91)
Sequences:	1331 (700)
Seq/√Len:	73.4

ECOLI - YEAX PAAE HCR
HALSA - Q9HS23 FER Q9HMG3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_D	80_Q	4.196	1.00
86_D	89_K	3.182	1.00
21_E	29_R	2.713	1.00
6_V	17_V	2.605	1.00
72_A	77_A	2.319	1.00
36_Y	39_R	2.311	1.00
52_S	84_V	2.294	1.00
5_T	16_E	2.253	1.00
5_T	14_T	2.211	1.00
23_I	83_L	2.161	1.00
50_I	83_L	2.157	1.00
48_A	74_T	2.133	1.00
47_S	67_E	2.088	1.00
7_E	12_G	2.041	1.00
37_S	40_V	1.925	1.00
26_A	30_E	1.903	1.00
28_L	39_R	1.872	1.00
50_I	72_A	1.853	1.00
48_A	85_L	1.804	1.00
49_K	71_Y	1.660	1.00
22_T	25_K	1.579	0.99
9_A	12_G	1.460	0.99
65_D	69_D	1.448	0.99
8_F	15_I	1.385	0.98
4_Y	81_T	1.385	0.98
7_E	14_T	1.376	0.98
20_T	78_R	1.356	0.98
55_V	77_A	1.304	0.98
21_E	26_A	1.260	0.97
54_D	81_T	1.248	0.97
11_A	86_D	1.214	0.96
89_K	92_P	1.210	0.96
37_S	44_L	1.188	0.96
9_A	84_V	1.159	0.95
64_T	67_E	1.117	0.94
15_I	27_C	1.109	0.94
18_S	21_E	1.103	0.94
17_V	79_P	1.100	0.94
51_E	84_V	1.085	0.93
24_L	36_Y	1.068	0.93
56_T	80_Q	1.052	0.92
7_E	84_V	1.028	0.91
42_M	61_R	1.025	0.91
42_M	48_A	1.012	0.90
37_S	42_M	0.997	0.90
37_S	62_G	0.957	0.88
44_L	62_G	0.947	0.87
6_V	26_A	0.939	0.87
16_E	52_S	0.937	0.87
6_V	27_C	0.937	0.87
57_Q	76_M	0.926	0.86
29_R	33_A	0.890	0.84
57_Q	72_A	0.890	0.84
53_G	81_T	0.868	0.82
44_L	47_S	0.867	0.82
24_L	39_R	0.866	0.82
12_G	84_V	0.860	0.82
11_A	36_Y	0.851	0.81
17_V	26_A	0.843	0.80
52_S	82_D	0.831	0.79
13_E	30_E	0.830	0.79
33_A	76_M	0.817	0.78
55_V	60_A	0.816	0.78
11_A	89_K	0.802	0.77
51_E	86_D	0.799	0.77
19_D	52_S	0.785	0.75
3_E	13_E	0.784	0.75
3_E	18_S	0.776	0.74
36_Y	63_L	0.767	0.74
8_F	87_R	0.754	0.72
59_A	78_R	0.748	0.72
36_Y	89_K	0.732	0.70
9_A	51_E	0.727	0.70
55_V	72_A	0.694	0.66
59_A	70_E	0.689	0.65
22_T	39_R	0.684	0.65
31_G	51_E	0.682	0.65
71_Y	89_K	0.681	0.65
40_V	89_K	0.675	0.64
36_Y	40_V	0.674	0.64
63_L	77_A	0.666	0.63
50_I	57_Q	0.663	0.62
11_A	49_K	0.661	0.62
14_T	85_L	0.653	0.61
38_C	43_C	0.653	0.61
44_L	67_E	0.651	0.61
57_Q	68_A	0.636	0.59
61_R	67_E	0.627	0.58
19_D	23_I	0.616	0.57
60_A	68_A	0.614	0.57
15_I	26_A	0.614	0.57
66_A	70_E	0.612	0.56
28_L	36_Y	0.611	0.56
45_A	71_Y	0.599	0.55
71_Y	76_M	0.593	0.54
8_F	86_D	0.589	0.54
22_T	28_L	0.588	0.53
37_S	73_L	0.588	0.53
7_E	10_G	0.583	0.53
16_E	70_E	0.581	0.53
32_I	77_A	0.578	0.52
60_A	65_D	0.573	0.52
33_A	37_S	0.570	0.51
32_I	87_R	0.569	0.51
34_Q	45_A	0.568	0.51
66_A	69_D	0.566	0.51
77_A	86_D	0.561	0.50
43_C	46_C	0.559	0.50
26_A	73_L	0.553	0.49
40_V	62_G	0.549	0.49
49_K	70_E	0.545	0.48
35_E	90_Y	0.544	0.48
23_I	74_T	0.543	0.48
32_I	52_S	0.540	0.47
11_A	14_T	0.540	0.47
26_A	29_R	0.538	0.47
60_A	76_M	0.538	0.47
25_K	39_R	0.537	0.47
4_Y	35_E	0.536	0.47
55_V	74_T	0.533	0.47
40_V	48_A	0.532	0.46
74_T	85_L	0.532	0.46
40_V	88_G	0.529	0.46
3_E	31_G	0.527	0.46
33_A	64_T	0.527	0.46
90_Y	93_S	0.525	0.46
8_F	88_G	0.524	0.46
37_S	64_T	0.517	0.45
35_E	88_G	0.517	0.45
21_E	50_I	0.514	0.44
42_M	67_E	0.514	0.44
5_T	70_E	0.513	0.44
27_C	34_Q	0.512	0.44
67_E	93_S	0.503	0.43
62_G	76_M	0.501	0.43
47_S	76_M	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zyyX	2	0.9817	99.9	0.447	Contact Map
4n58A	4	0.9817	99.9	0.452	Contact Map
1iueA	1	0.8716	99.9	0.48	Contact Map
1frrA	1	0.844	99.9	0.48	Contact Map
1qoaA	1	0.8532	99.9	0.484	Contact Map
1awdA	2	0.8349	99.8	0.485	Contact Map
1frdA	1	0.8532	99.8	0.487	Contact Map
2piaA	1	0.789	99.8	0.488	Contact Map
1wriA	1	0.8257	99.8	0.49	Contact Map
3wcqA	1	0.844	99.8	0.493	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.